Recombinant Human ASCL1
| Cat.No. : | ASCL1-28522TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 137-236 of Human MASH1/Achaete-scute homolog 1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5-CANNTG-3). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. |
| Protein length : | 100 amino acids |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Source : | Wheat germ |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF |
| Sequence Similarities : | Contains 1 basic helix-loop-helix (bHLH) domain. |
| Tag : | Non |
| Gene Name | ASCL1 achaete-scute complex homolog 1 (Drosophila) [ Homo sapiens ] |
| Official Symbol | ASCL1 |
| Synonyms | ASCL1; achaete-scute complex homolog 1 (Drosophila); achaete scute complex (Drosophila) homolog like 1 , achaete scute complex like 1 (Drosophila); achaete-scute homolog 1; ASH1; bHLHa46; HASH1; |
| Gene ID | 429 |
| mRNA Refseq | NM_004316 |
| Protein Refseq | NP_004307 |
| MIM | 100790 |
| Uniprot ID | P50553 |
| Chromosome Location | 12q22-q23 |
| Pathway | Delta-Notch Signaling Pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; SIDS Susceptibility Pathways, organism-specific biosystem; |
| Function | DNA binding; E-box binding; bHLH transcription factor binding; double-stranded DNA binding; protein binding; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASCL1 Products
Required fields are marked with *
My Review for All ASCL1 Products
Required fields are marked with *
0
Inquiry Basket
