Recombinant Full Length Human ARHGAP1 Protein, C-Flag-tagged
Cat.No. : | ARHGAP1-2058HFL |
Product Overview : | Recombinant Full Length Human ARHGAP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of a large family of proteins that activate Rho-type guanosine triphosphate (GTP) metabolizing enzymes. The encoded protein contains a SRC homology 3 domain and interacts with Bcl-2-associated protein family members. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 50.3 kDa |
AA Sequence : | MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYDIARH QIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLSWL RDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISFKFGQKIFYVNYLSELSEHVKLEQLGIPRQV LKYDDFLKSTQKSPATAPKPMPPRPPLPNQQFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGI FRRSANTQVVREVQQKYNMGLPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRV PATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFT KFLLDHQGELFPSPDPSGL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | ARHGAP1 Rho GTPase activating protein 1 [ Homo sapiens (human) ] |
Official Symbol | ARHGAP1 |
Synonyms | RHOGAP; RHOGAP1; CDC42GAP; p50rhoGAP |
Gene ID | 392 |
mRNA Refseq | NM_004308.5 |
Protein Refseq | NP_004299.1 |
MIM | 602732 |
UniProt ID | Q07960 |
◆ Recombinant Proteins | ||
ARHGAP1-9812H | Recombinant Human ARHGAP1, GST-tagged | +Inquiry |
ARHGAP1-37H | Active Recombinant Human ARHGAP1 Protein (Full Length), N-His tagged | +Inquiry |
ARHGAP1-373H | Recombinant Human ARHGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGAP1-387R | Recombinant Rhesus monkey ARHGAP1 Protein, His-tagged | +Inquiry |
Arhgap1-1678M | Recombinant Mouse Arhgap1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGAP1-8745HCL | Recombinant Human ARHGAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARHGAP1 Products
Required fields are marked with *
My Review for All ARHGAP1 Products
Required fields are marked with *
0
Inquiry Basket