Recombinant Full Length Heterosigma Akashiwo Cytochrome C Biogenesis Protein Ccs1(Ccs1) Protein, His-Tagged
Cat.No. : | RFL12816HF |
Product Overview : | Recombinant Full Length Heterosigma akashiwo Cytochrome c biogenesis protein ccs1(ccs1) Protein (B2XTC6) (1-423aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Heterosigma akashiwo |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-423) |
Form : | Lyophilized powder |
AA Sequence : | MEKIFKILANLKFAIALLLLISITITFGSIIEQDQTLDYYKQNYPLTNPIGGFLTWKVIN MFQLNHIYKNFWFISLLLSLGISLIACTFFQQFPGIKFSRRCYFSNNPRKTDFQTQLKTN LSRNIIYTIISEGYFVFQQKKNFYGTKGIIGRIAPVFVHLSIILILLGSIFASLGGFNSQ ELIGKGEIFHIQNVTSSGPLTKLSQQAIRVNDFWINYYPNNKIKQFYSNLSIINGDGQEV RSKTISVNKPLIYKDLTFYQTDWNLLGLRISHNNKNFQIPVIQTTQNLNKVWLTWLPLES NTSKNLSGETIIINNYKGTIYIYDNNGQLNKKIELSNFIENKNYKLIEFLSVTGIQIKSD PGILFIYFGFGFLMVSTILSYLSFSQVWLGIDYLEQNNIKLTVNAKTNRTKVLALTVRIQ PFL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccs1 |
Synonyms | ccs1; Heak293_Cp117; Cytochrome c biogenesis protein Ccs1 |
UniProt ID | B2XTC6 |
◆ Native Proteins | ||
YIgG-138C | Native Chicken Yolk Immunoglobulin | +Inquiry |
EDN1-8305H | Native Human EDN1 | +Inquiry |
LYZ-29007TH | Active Native Human LYZ | +Inquiry |
IgE-507H | Native Human IgE protein | +Inquiry |
APOA1-8344H | Native Human APOA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPSB2-835HCL | Recombinant Human TPSB2 293 Cell Lysate | +Inquiry |
RBM47-532HCL | Recombinant Human RBM47 lysate | +Inquiry |
TLR3-2447MCL | Recombinant Mouse TLR3 cell lysate | +Inquiry |
HCT-116-031HCL | Human HCT-116 Cell Nuclear Extract | +Inquiry |
AGT-1842MCL | Recombinant Mouse AGT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ccs1 Products
Required fields are marked with *
My Review for All ccs1 Products
Required fields are marked with *
0
Inquiry Basket