Recombinant Full Length Zinc Finger Protein-Like 1 Homolog(Y45G12B.2) Protein, His-Tagged
Cat.No. : | RFL2397CF |
Product Overview : | Recombinant Full Length Zinc finger protein-like 1 homolog(Y45G12B.2) Protein (Q9N4Y9) (1-309aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-309) |
Form : | Lyophilized powder |
AA Sequence : | MGLCKCPKRKVTNLFCYEHRVNVCEFCLVDNHPNCVVQSYLTWLTDQDYDPNCSLCKTTL AEGDTIRLNCLHLLHWKCFDEWAANFPATTAPAGYRCPCCSQEVFPPINEVSPLIEKLRE QLKQSNWARAALGLPTLPELNRPVPSPAPPQLKNAPVMHKEVPVHNNRSSTPATHLEMED TASYSVSNNDVTFARKKNYGAESSSDTRPLLQLRDADNEENKYKRRPTMDWMRGLWRAKH GGSGVPQERASAKKIALFVIFLAVLALITIIMVMKRAGYSGEHSSDPLFDPMANPNIRVA VEDSRLPHV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Y45G12B.2 |
Synonyms | Y45G12B.2; Zinc finger protein-like 1 homolog |
UniProt ID | Q9N4Y9 |
◆ Recombinant Proteins | ||
Cib3-787M | Recombinant Mouse Cib3 Protein, His-tagged | +Inquiry |
DNMT3A-1122HFL | Recombinant Full Length Human DNMT3A Protein, C-Flag-tagged | +Inquiry |
MPXV-0418 | Recombinant Monkeypox Virus D4L Protein | +Inquiry |
CABP7-3516H | Recombinant Human Calcium Binding Protein 7, His-tagged | +Inquiry |
PUS7-2075H | Recombinant Human PUS7, GST-tagged | +Inquiry |
◆ Native Proteins | ||
AMY1A-8023H | Native Human Salivary Amylase (Alpha) | +Inquiry |
SERPINA1-5358H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 1 | +Inquiry |
Proteoglycans-52H | Native Human Proteoglycans | +Inquiry |
Tropomyosin/Troponin-895R | Native Rabbit Tropomyosin/Troponin Protein | +Inquiry |
ACTA1-854P | Native Porcine ACTA1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CISD2-7489HCL | Recombinant Human CISD2 293 Cell Lysate | +Inquiry |
RNMT-2262HCL | Recombinant Human RNMT 293 Cell Lysate | +Inquiry |
ETF1-6533HCL | Recombinant Human ETF1 293 Cell Lysate | +Inquiry |
C16orf71-84HCL | Recombinant Human C16orf71 lysate | +Inquiry |
SSX3-1447HCL | Recombinant Human SSX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Y45G12B.2 Products
Required fields are marked with *
My Review for All Y45G12B.2 Products
Required fields are marked with *
0
Inquiry Basket