Recombinant Full Length Helicobacter Pylori Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL20581HF |
Product Overview : | Recombinant Full Length Helicobacter pylori ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (P71408) (1-632aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Helicobacter Pylori |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-632) |
Form : | Lyophilized powder |
AA Sequence : | MKPTNEPKKPFFQSPIILAVLGGILLIFFLRSFNSDGSFSDNFLASSTKNVSYHEIKQLI SNNEVENVSIGQTLIKASHKEGNNRVIYIAKRVPDLTLVPLLDEKKINYSGFSESNFFTD MLGWLMPILVILGLWMFMANRMQKNMGGGIFGMGSAKKLINAEKPNVRFNDMAGNEEAKE EVVEIVDFLKYPERYANLGAKIPKGVLLVGPPGTGKTLLAKAVAGEAHVPFFSMGGSSFI EMFVGLGASRVRDLFETAKKQAPSIIFIDEIDAIGKSRAAGGVVSGNDEREQTLNQLLAE MDGFGSENAPVIVLAATNRPEILDPALMRPGRFDRQVLVDKPDFNGRVEILKVHIKGVKL ANDVNLQEVAKLTAGLAGADLANIINEAALLAGRNNQKEVRQQHLKEAVERGIAGLEKKS RRISPKEKKIVAYHESGHAVISEMTKGSARVNKVSIIPRGMAALGYTLNTPEENKYLMQK HELIAEIDVLLGGRAAEDVFLEEISTGASNDLERATDIIKGMVSYYGMSSVSGLMVLEKQ RNAFLGGGYGSSREFSEKTAEEMDLFIKNLLEERYKHVKQTLSDYREAIEIMVKELFDKE VITGERVREIISEYEVANNLESRLIPLEEQAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; HP_1069; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | P71408 |
◆ Recombinant Proteins | ||
Ednrb-2730M | Recombinant Mouse Ednrb Protein, Myc/DDK-tagged | +Inquiry |
ALCAM-4382H | Recombinant Human ALCAM protein, His-SUMO-tagged | +Inquiry |
NICN1-6060M | Recombinant Mouse NICN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL24274SF | Recombinant Full Length Shewanella Denitrificans Upf0114 Protein Sden_0436(Sden_0436) Protein, His-Tagged | +Inquiry |
CNGA3-157H | Recombinant Human CNGA3 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Interferon alfa-P029H | Native Human interferon alpha therapeutic protein (Interferon alfa-n3) | +Inquiry |
CTSH-27404TH | Native Human CTSH | +Inquiry |
Adv2-10 | Native Adenovirus Type 2 Hexon Antigen | +Inquiry |
Avidin Biotin-27 | Native Avidin Protein | +Inquiry |
CPD A-036H | Active Native Human Pancreatic Carboxypeptidase A | +Inquiry |
◆ Cell & Tissue Lysates | ||
SH3KBP1-1600HCL | Recombinant Human SH3KBP1 cell lysate | +Inquiry |
ROCK2-2255HCL | Recombinant Human ROCK2 293 Cell Lysate | +Inquiry |
POC1A-3063HCL | Recombinant Human POC1A 293 Cell Lysate | +Inquiry |
TGFBI-2766HCL | Recombinant Human TGFBI cell lysate | +Inquiry |
PKNOX2-1364HCL | Recombinant Human PKNOX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket