Recombinant Human CNGA3 protein, GST-tagged

• Cat.No.: CNGA3-157H
• Product Overview: Recombinant Human CNGA3 protein(NP_001073347)(590-694 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 590-694 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: EYPEAKKALEEKGRQILMKDNLIDEELARAGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQVKGGGDKPLADGEVPGDATKTEDKQQ
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
• Concentration: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CNGA3 cyclic nucleotide gated channel alpha 3 [ Homo sapiens ]
• Official Symbol: CNGA3
• Synonyms: CNGA3; cyclic nucleotide gated channel alpha 3; ACHM2, CNCG3; cyclic nucleotide-gated cation channel alpha-3; CCNC1; CCNCa; CNG3; CNG-3; CNG channel alpha-3; cyclic nucleotide-gated channel alpha-3; cone photoreceptor cGMP-gated channel alpha subunit; cone photoreceptor cGMP-gated channel subunit alpha; ACHM2; CNCG3; CCNCalpha
• Gene ID: 1261
• mRNA Refseq: NM_001079878
• Protein Refseq: NP_001073347
• MIM: 600053
• UniProt ID: Q16281