Recombinant Full Length Helicobacter Pylori Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL22035HF |
Product Overview : | Recombinant Full Length Helicobacter pylori Apolipoprotein N-acyltransferase(lnt) Protein (O24982) (1-425aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Helicobacter Pylori |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-425) |
Form : | Lyophilized powder |
AA Sequence : | MRLLLFNQNAFLLACMFVSSVYVNAVLDAYAIENPYISITLTSLLAPLSMLAFLKTPRNS AFALGFFVGALLFYWCALSFRYSDFTYLLPLIIVLIALVYGVLFYLLLYFENPYFRLLSF LGSSFIHPFGFDWLVPDSFFSYSVFRVDKLSLGLVFLACIFLSTKPLKKYRIIGVLLLLG ALDFNGFKTSDLKKVGNIELVSTKTPQDLKFDSSYLNDIENNILKEIKLAQSKQKTLIVF PETAYPIALENSPFKAKLEDLSDNIAILIGTLRTQGYNLYNSSFLFSKESVQIADKVILA PFGETMPLPEFLQKPLEKLFFGESTYLYRNAPHFSDFTLDDFTFRPLICYEGTSKPAYSN SPSKIFIVMSNNAWFSPSIEPTLQRTLLKYYARRYDKIILHSANFSTSYILSPSLLGDIL FRKRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; HP_0180; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | O24982 |
◆ Recombinant Proteins | ||
CPLX3-1005R | Recombinant Rhesus monkey CPLX3 Protein, His-tagged | +Inquiry |
C1QTNF6-469H | Recombinant Human C1QTNF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
SYAP1-11180Z | Recombinant Zebrafish SYAP1 | +Inquiry |
MET-1812C | Recombinant Cynomolgus/Rhesus MET protein, His-tagged, Biotinylated | +Inquiry |
PSAT1-1113M | Recombinant Mouse PSAT1 Protein (1-370 aa), His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
ELANE-8104H | Native Human Neutrophil Elastase | +Inquiry |
LH-92P | Native Porcine LH | +Inquiry |
Pzp-3279H | Native Human Pzp | +Inquiry |
Lectin-1752A | Active Native Aleuria Aurantia Lectin Protein, Biotinylated | +Inquiry |
Compound E-12 | Compound E, Antibotics Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
REEP3-2427HCL | Recombinant Human REEP3 293 Cell Lysate | +Inquiry |
BMP4-8432HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
CYBB-7138HCL | Recombinant Human CYBB 293 Cell Lysate | +Inquiry |
RAB1B-2622HCL | Recombinant Human RAB1B 293 Cell Lysate | +Inquiry |
NETO1-2197HCL | Recombinant Human NETO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket