Recombinant Full Length Halobacterium Salinarum Sensory Rhodopsin-2(Sop2) Protein, His-Tagged
Cat.No. : | RFL16203HF |
Product Overview : | Recombinant Full Length Halobacterium salinarum Sensory rhodopsin-2(sop2) Protein (P71411) (1-237aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Halobacterium Salinarum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-237) |
Form : | Lyophilized powder |
AA Sequence : | MALTTWFWVGAVGMLAGTVLPIRDCIRHPSHRRYDLVLAGITGLAAIAYTTMGLGITATT VGDRTVYLARYIDWLVTTPLIVLYLAMLARPGHRTSAWLLAADVFVIAAGIAAALTTGVQ RWLFFAVGAAGYAALLYGLLGTLPRALGDDPRVRSLFVTLRNITVVLWTLYPVVWLLSPA GIGILQTEMYTIVVVYLDFISKVAFVAFAVLGADAVSRLVAADAAAPATAEPTPDGD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sop2 |
Synonyms | sop2; sopII; VNG_1764G; Sensory rhodopsin-2; Sensory rhodopsin II; SR-II |
UniProt ID | P71411 |
◆ Recombinant Proteins | ||
Rabl3-5342M | Recombinant Mouse Rabl3 Protein, Myc/DDK-tagged | +Inquiry |
SNRPA-493H | Recombinant Human SNRPA protein, His-tagged | +Inquiry |
FBXW8-3977H | Recombinant Human FBXW8 Protein, GST-tagged | +Inquiry |
CBLN3-1266M | Recombinant Mouse CBLN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
COPS7B-1969HF | Recombinant Full Length Human COPS7B Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ACTC1-885B | Native Bovine ACTC1 Protein, Pyrene labeled | +Inquiry |
Thrombin-23B | Native Bovine Thrombin | +Inquiry |
IgG-118H | Native Horse Immunoglobulin G | +Inquiry |
GALM-40P | Active Native Porcine Mutarotase | +Inquiry |
Collagen Type I-48H | Native Human tendon collagen type I | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR4A2-3708HCL | Recombinant Human NR4A2 293 Cell Lysate | +Inquiry |
TRIM28-1825HCL | Recombinant Human TRIM28 cell lysate | +Inquiry |
RAG-1464M | RAG (mouse renal adenocarcinoma) whole cell lysate | +Inquiry |
MFN1-4348HCL | Recombinant Human MFN1 293 Cell Lysate | +Inquiry |
SNX20-1640HCL | Recombinant Human SNX20 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All sop2 Products
Required fields are marked with *
My Review for All sop2 Products
Required fields are marked with *
0
Inquiry Basket