Recombinant Full Length Cryptomeria Japonica Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL20785CF |
Product Overview : | Recombinant Full Length Cryptomeria japonica Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (B1VKC1) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cryptomeria japonica (Japanese cedar) (Cupressus japonica) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLIAVHIMHTALVSGWAGSMALYELAVFDPSDPILDPMWRQGM FVIPFMTRLGIKDSWGGWSITGETGSNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL DVFCDSRTGKPSLDLPKIFGIHLFLSGAACFGFGAFHVTGLYGPGIWVSDPYGLTGKIQP VNPAWGAEGFDPFVPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFIVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIDRRVRAGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHPIFKDKNGHELFVRRMP TFFETFPVVLVDEEGIVKADVPFRRAESKYSVEQVGVTVEFYGGELDGVSFGDPAIVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | B1VKC1 |
◆ Native Proteins | ||
LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
C3-147C | Active Native Botulinum C3 Enzyme | +Inquiry |
ALA-02B | Native Bovine α-Lactalbumin Protein | +Inquiry |
ALB-128C | Native Canine Serum Albumin | +Inquiry |
Collagen-57H | Native Human Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP4-7836HCL | Recombinant Human CASP4 293 Cell Lysate | +Inquiry |
MIER3-4316HCL | Recombinant Human MIER3 293 Cell Lysate | +Inquiry |
UXT-442HCL | Recombinant Human UXT 293 Cell Lysate | +Inquiry |
PARVA-3426HCL | Recombinant Human PARVA 293 Cell Lysate | +Inquiry |
HIST1H4A-5527HCL | Recombinant Human HIST1H4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket