Recombinant Full Length Lobularia Maritima Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL20367LF |
Product Overview : | Recombinant Full Length Lobularia maritima Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (A4QLM0) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lobularia maritima (Sweet alyssum) (Alyssum maritimum) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAAAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSVSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | A4QLM0 |
◆ Recombinant Proteins | ||
PIH1D2-12794M | Recombinant Mouse PIH1D2 Protein | +Inquiry |
CCDC127-483R | Recombinant Rhesus Macaque CCDC127 Protein, His (Fc)-Avi-tagged | +Inquiry |
Spint1-405M | Active Recombinant Mouse Serine Protease Inhibitor, Kunitz Type 1, His-tagged | +Inquiry |
YCZO-3514B | Recombinant Bacillus subtilis YCZO protein, His-tagged | +Inquiry |
NPR3-27852TH | Recombinant Human NPR3 | +Inquiry |
◆ Native Proteins | ||
GG-183H | Native Human Gamma Globulin | +Inquiry |
Glutamate oxaloacetate transaminase-385 | Active Native E. coli Glutamate oxaloacetate transaminase protein. | +Inquiry |
CST3-4309H | Native Human CST3 Protein | +Inquiry |
ALPI-8348B | Native Bovine ALPI | +Inquiry |
PLG -62R | Native Rabbit plasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHI3L1-1715MCL | Recombinant Mouse CHI3L1 cell lysate | +Inquiry |
PROC-852HCL | Recombinant Human PROC cell lysate | +Inquiry |
KDELR3-4999HCL | Recombinant Human KDELR3 293 Cell Lysate | +Inquiry |
ENG-2457HCL | Recombinant Human ENG cell lysate | +Inquiry |
CD36-1109CCL | Recombinant Cynomolgus CD36 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket