Recombinant Full Length Exiguobacterium Sibiricum Upf0365 Protein Exig_0818 (Exig_0818) Protein, His-Tagged
Cat.No. : | RFL25040EF |
Product Overview : | Recombinant Full Length Exiguobacterium sibiricum UPF0365 protein Exig_0818 (Exig_0818) Protein (B1YL66) (1-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Exiguobacterium sibiricum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-327) |
Form : | Lyophilized powder |
AA Sequence : | MTPELLTVLLITGGILIFLAIFFTLVPIPLWISSLAAGVRVSIFTLVGMRLRRVTPSKIV NPLIKAVKAGINLNTNQLESHYLAGGNVDRVVNALIAAHRANIELSFERAAAIDLAGRNV LEAVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIDRLVGGAGEETVIARVGEGV ISTIGSCQDQKEVLENPEMISRTVLAKGLDSGTAFEILSIDIADVDIGKNIGAVLQTDQA EADKNIAQAKAEERRAMAIASEQEMKSRVEEMRAKVVAAEAEVPLAIAEALRDGNFSVMD YANYLNVTADTKMRQAIGGQSSPNDTQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Exig_0818 |
Synonyms | floA; Exig_0818; Flotillin-like protein FloA |
UniProt ID | B1YL66 |
◆ Recombinant Proteins | ||
Gip-6744M | Recombinant Mouse Gip protein, hFc-tagged | +Inquiry |
HIST1H1B-4174M | Recombinant Mouse HIST1H1B Protein, His (Fc)-Avi-tagged | +Inquiry |
ETV1-3289Z | Recombinant Zebrafish ETV1 | +Inquiry |
KYNU-4423H | Recombinant Human KYNU protein, GST-tagged | +Inquiry |
TEKT2-756C | Recombinant Cynomolgus Monkey TEKT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CTSG-1649H | Active Native Human CTSG protein | +Inquiry |
Lectin-1853U | Active Native Ulex Europaeus Agglutinin I Protein, Fluorescein labeled | +Inquiry |
Cysteine-01C | Native Clostridium histolyticum Cysteine (C41, heavy chain) | +Inquiry |
Proteoglycans-51C | Native Chicken Proteoglycans | +Inquiry |
Insulin-04B | Native Bovine Insulin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TXNDC15-625HCL | Recombinant Human TXNDC15 293 Cell Lysate | +Inquiry |
PPP2R2B-2923HCL | Recombinant Human PPP2R2B 293 Cell Lysate | +Inquiry |
SCART1-1020HCL | Recombinant Human SCART1 cell lysate | +Inquiry |
TRMT61A-207HCL | Recombinant Human TRMT61A cell lysate | +Inquiry |
Persimmon-704P | Persimmon Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Exig_0818 Products
Required fields are marked with *
My Review for All Exig_0818 Products
Required fields are marked with *
0
Inquiry Basket