Recombinant Full Length Escherichia Coli Uncharacterized Protein Ygjq(Ygjq) Protein, His-Tagged
Cat.No. : | RFL5427EF |
Product Overview : | Recombinant Full Length Escherichia coli Uncharacterized protein ygjQ(ygjQ) Protein (P42598) (1-230aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-230) |
Form : | Lyophilized powder |
AA Sequence : | MLRAFARLLLRICFSRRTLKIACLLLLVAGATILIADRVMVNASKQLTWSDVNAVPARNV GLLLGARPGNRYFTRRIDTAAALYHAGKVKWLLVSGDNGRKNYDEASGMQQALIAKGVPA KVIFCDYAGFSTLDSVVRAKKVFGENHITIISQEFHNQRAIWLAKQYGIDAIGFNAPDLN MKHGFYTQLREKLARVSAVIDAKILHRQPKYLGPSVMIGPFSEHGCPAQK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ygjQ |
Synonyms | ygjQ; b3086; JW3057; Uncharacterized protein YgjQ |
UniProt ID | P42598 |
◆ Native Proteins | ||
IgA-7431M | Native Mouse Immunoglobulin A | +Inquiry |
Complement C3b-47H | Native Human Complement C3b | +Inquiry |
PLP-21 | Native Mouse/Rat PLP (139-151) Protein | +Inquiry |
IgG-332S | Native Swine IgG | +Inquiry |
TPO-702H | Native Human Thyroid Peroxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
PECR-3309HCL | Recombinant Human PECR 293 Cell Lysate | +Inquiry |
GFRA1-2426HCL | Recombinant Human GFRA1 cell lysate | +Inquiry |
GPR78-5777HCL | Recombinant Human GPR78 293 Cell Lysate | +Inquiry |
EFHB-6702HCL | Recombinant Human EFHB 293 Cell Lysate | +Inquiry |
HGD-5571HCL | Recombinant Human HGD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ygjQ Products
Required fields are marked with *
My Review for All ygjQ Products
Required fields are marked with *
0
Inquiry Basket