Recombinant Full Length Escherichia Coli Outer Membrane Protein Tolc(Tolc) Protein, His-Tagged
Cat.No. : | RFL24718EF |
Product Overview : | Recombinant Full Length Escherichia coli Outer membrane protein tolC(tolC) Protein (P02930) (23-493aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (23-493) |
Form : | Lyophilized powder |
AA Sequence : | ENLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPLLPQLGLGADYTYSNGYRDANGI NSNATSASLQLTQSIFDMSKWRALTLQEKAAGIQDVTYQTDQQTLILNTATAYFNVLNAI DVLSYTQAQKEAIYRQLDQTTQRFNVGLVAITDVQNARAQYDTVLANEVTARNNLDNAVE QLRQITGNYYPELAALNVENFKTDKPQPVNALLKEAEKRNLSLLQARLSQDLAREQIRQA QDGHLPTLDLTASTGISDTSYSGSKTRGAAGTQYDDSNMGQNKVGLSFSLPIYQGGMVNS QVKQAQYNFVGASEQLESAHRSVVQTVRSSFNNINASISSINAYKQAVVSAQSSLDAMEA GYSVGTRTIVDVLDATTTLYNAKQELANARYNYLINQLNIKSALGTLNEQDLLALNNALS KPVSTNPENVAPQTPEQNAIADGYAPDSPAPVVQQTSARTTTSNGHNPFRN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tolC |
Synonyms | tolC; colE1-i; mtcB; mukA; refI; toc; weeA; b3035; JW5503; Outer membrane protein TolC; Multidrug efflux pump subunit TolC; Outer membrane factor TolC |
UniProt ID | P02930 |
◆ Recombinant Proteins | ||
F3-2109HFL | Recombinant Full Length Human F3 Protein, C-Flag-tagged | +Inquiry |
RNPEP-2003HFL | Recombinant Full Length Human RNPEP Protein, C-Flag-tagged | +Inquiry |
CMTR1-3273H | Recombinant Human CMTR1 Protein, MYC/DDK-tagged | +Inquiry |
CEP57L1-1104Z | Recombinant Zebrafish CEP57L1 | +Inquiry |
RCL1-3864H | Recombinant Human RCL1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-514H | Native Human IgG | +Inquiry |
OXT-5360H | Native Human Oxytocin, Prepropeptide | +Inquiry |
FABP3-09M | Native Mouse FABP3 protein | +Inquiry |
SERPING1-97H | Active Native Human C1 Esterase Inhibitor (C1-INH) | +Inquiry |
B. afzelii-21 | Native Borrelia afzelii Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
MANBAL-4521HCL | Recombinant Human MANBAL 293 Cell Lysate | +Inquiry |
IKZF4-851HCL | Recombinant Human IKZF4 cell lysate | +Inquiry |
FCER2-1814HCL | Recombinant Human FCER2 cell lysate | +Inquiry |
Brain-809H | Hamster Brain Membrane Lysate, Total Protein | +Inquiry |
CLDN8-7458HCL | Recombinant Human CLDN8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tolC Products
Required fields are marked with *
My Review for All tolC Products
Required fields are marked with *
0
Inquiry Basket