Recombinant Full Length Human F3 Protein, C-Flag-tagged
Cat.No. : | F3-2109HFL |
Product Overview : | Recombinant Full Length Human F3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces, for example, on monocytes. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. Platelets and monocytes have been shown to express this coagulation factor under procoagulatory and proinflammatory stimuli, and a major role in HIV-associated coagulopathy has been described. Platelet-dependent monocyte expression of coagulation factor III has been described to be associated with Coronavirus Disease 2019 (COVID-19) severity and mortality. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. Alternate splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 29.5 kDa |
AA Sequence : | METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQI STKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNL GQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLID VDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFREIFYIIGAVVFVVIILVIILAISLHKCRKA GVGQSWKENSPLNVS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Complement and coagulation cascades |
Full Length : | Full L. |
Gene Name | F3 coagulation factor III, tissue factor [ Homo sapiens (human) ] |
Official Symbol | F3 |
Synonyms | TF; TFA; CD142 |
Gene ID | 2152 |
mRNA Refseq | NM_001993.5 |
Protein Refseq | NP_001984.1 |
MIM | 134390 |
UniProt ID | P13726 |
◆ Recombinant Proteins | ||
F3-4499HF | Recombinant Full Length Human F3 Protein | +Inquiry |
F3-1029R | Recombinant Rabbit F3 Protein, His-tagged | +Inquiry |
F3-2046H | Recombinant Human F3 Protein, His-tagged | +Inquiry |
F3-565H | Recombinant Human F3 Protein (Met1-Ser295), His-tagged | +Inquiry |
F3-883H | Recombinant Human F3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
F3-1256RCL | Recombinant Rat F3 cell lysate | +Inquiry |
F3-1691HCL | Recombinant Human F3 cell lysate | +Inquiry |
F3-2503MCL | Recombinant Mouse F3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All F3 Products
Required fields are marked with *
My Review for All F3 Products
Required fields are marked with *
0
Inquiry Basket