Recombinant Full Length Human RNPEP Protein, C-Flag-tagged
Cat.No. : | RNPEP-2003HFL |
Product Overview : | Recombinant Full Length Human RNPEP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable metalloaminopeptidase activity. Predicted to be involved in proteolysis. Located in extracellular exosome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 72.4 kDa |
AA Sequence : | MASGEHSPGSGAARRPLHSAQAVDVASASNFRAFELLHLHLDLRAEFGPPGPGAGSRGLSGTAVLDLRCL EPEGAAELRLDSHPCLEVTAAALRRERPGSEEPPAEPVSFYTQPFSHYGQALCVSFPQPCRAAERLQVLL TYRVGEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFPCFDTPAVKYKYSALIEVPDGFTAVMSASTW EKRGPNKFFFQMCQPIPSYLIALAIGDLVSAEVGPRSRVWAEPCLIDAAKEEYNGVIEEFLATGEKLFGP YVWGRYDLLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGF TMYAQRRISTILFGAAYTCLEAATGRALLRQHMDITGEENPLNKLRVKIEPGVDPDDTYNETPYEKGFCF VSYLAHLVGDQDQFDSFLKAYVHEFKFRSILADDFLDFYLEYFPELKKKRVDIIPGFEFDRWLNTPGWPP YLPDLSPGDSLMKPAEELAQLWAAEELDMKAIEAVAISPWKTYQLVYFLDKILQKSPLPPGNVKKLGDTY PSISNARNAELRLRWGQIVLKNDHQEDFWKVKEFLHNQGKQKYTLPLYHAMMGGSEVAQTLAKETFASTA SQLHSNVVNYVQQIVAPKGS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease, Secreted Protein |
Full Length : | Full L. |
Gene Name | RNPEP arginyl aminopeptidase [ Homo sapiens (human) ] |
Official Symbol | RNPEP |
Synonyms | APB; AP-B |
Gene ID | 6051 |
mRNA Refseq | NM_020216.4 |
Protein Refseq | NP_064601.3 |
MIM | 602675 |
UniProt ID | Q9H4A4 |
◆ Recombinant Proteins | ||
Ache-511M | Recombinant Mouse Ache Protein, MYC/DDK-tagged | +Inquiry |
MCAM-887HFL | Recombinant Full Length Human MCAM Protein, C-Flag-tagged | +Inquiry |
PRAMEF10-5058H | Recombinant Human PRAMEF10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SE0144-4459S | Recombinant Staphylococcus epidermidis ATCC 12228 SE0144 protein, His-tagged | +Inquiry |
LMNB1-9438Z | Recombinant Zebrafish LMNB1 | +Inquiry |
◆ Native Proteins | ||
GOT1-5353P | Active Native Porcine GOT1 protein | +Inquiry |
CMV-06 | Native Cytomegalovirus Antigen | +Inquiry |
HDL-201H | Native Human High Density Lipoprotein | +Inquiry |
HPIV1ag-276V | Native Parainfluenza Virus type 1(strain Sendai) Protein | +Inquiry |
RNASE3-5318H | Native Human Ribonuclease, RNase A Family, 3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTRA1-5329HCL | Recombinant Human HTRA1 293 Cell Lysate | +Inquiry |
NPTN-3727HCL | Recombinant Human NPTN 293 Cell Lysate | +Inquiry |
FAIM-6466HCL | Recombinant Human FAIM 293 Cell Lysate | +Inquiry |
KIAA1967-924HCL | Recombinant Human KIAA1967 cell lysate | +Inquiry |
SLAMF9-1808HCL | Recombinant Human SLAMF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All RNPEP Products
Required fields are marked with *
My Review for All RNPEP Products
Required fields are marked with *
0
Inquiry Basket