Recombinant Full Length Escherichia Coli O17:K52:H18 Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL25897EF |
Product Overview : | Recombinant Full Length Escherichia coli O17:K52:H18 Bifunctional protein aas(aas) Protein (B7N768) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MLFSFFRNLCRVLYRVRVTGDTQALKGERVLITPNHVSFIDGILLALFLPVRPVFAVYTS ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVEMPDAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK TLFVGRILEKYSIEGERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFSHLLMPRLAQV KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYDTGDIVR FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT TDNELTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWVDEAEQHDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; ECUMN_3163; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Lo |
UniProt ID | B7N768 |
◆ Recombinant Proteins | ||
LPO-5034H | Recombinant Human LPO protein, His&Myc-tagged | +Inquiry |
ASIP-6018H | Recombinant Human ASIP protein(23-132aa), His&Myc-tagged | +Inquiry |
RFL249CF | Recombinant Full Length Twik Family Of Potassium Channels Protein 7(Twk-7) Protein, His-Tagged | +Inquiry |
YQEU-1417B | Recombinant Bacillus subtilis YQEU protein, His-tagged | +Inquiry |
VPS26B-18367M | Recombinant Mouse VPS26B Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1856V | Active Native Vicia Villosa Lectin Protein, Biotinylated | +Inquiry |
ACPP-29981TH | Native Human ACPP | +Inquiry |
CKM-26522TH | Native Human CKM | +Inquiry |
Annexin-013 | Native Annexin Protein, Gold conjugated | +Inquiry |
IGHD -20H | Native Human IgD | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK1-743MCL | Recombinant Mouse KLK1 cell lysate | +Inquiry |
RNPS1-2258HCL | Recombinant Human RNPS1 293 Cell Lysate | +Inquiry |
TMEM220-964HCL | Recombinant Human TMEM220 293 Cell Lysate | +Inquiry |
Hippocampus-235H | Human Hippocampus (Alzheimers Disease) Membrane Lysate | +Inquiry |
KRT18-4877HCL | Recombinant Human KRT18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket