Recombinant Full Length Escherichia Coli Inner Membrane Protein Yeer(Yeer) Protein, His-Tagged
Cat.No. : | RFL26705EF |
Product Overview : | Recombinant Full Length Escherichia coli Inner membrane protein yeeR(yeeR) Protein (P76361) (1-510aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-510) |
Form : | Lyophilized powder |
AA Sequence : | MLQIVGALILLIAGFAILRLLFRALISTASALAGLILLCLFGPALLAGYITERITRLFHI RWLAGVFLTIAGMIISFMWGLDGKHIALEAHTFDSVKFILTTALAGGLLAVPLQIKNIQQ NGITPEDISKEINGYYCCFYTAFFLMACSACAPLIALQYDISPSLMWWGGLLYWLAALVT LLWAASQIQALKKLTCAISQTLEEQPVLNSKSWLTSLQNDYSLPDSLTERIWLTLISQRI SRGELREFELADGNWLLNNAWYERNMAGFNEQLKENLSFTPDELKTLFRNRLNLSPEAND DFLDRCLDGGDWYPFSEGRRFVSFHHVDELRICASCGLTEVHHAPENHKPDPEWYCSSLC RETETLCQEIYERPYNSFISDATANGLILMKLPETWSTNEKMFASGGQGHGFAAERGNHI VDRVRLKNARILGDNNARNGADRLVSGTEIQTKYCSTAARSVGAAFDGQNGQYRYMGNNG PMQLEVPRDQYAGAVETMRNKIREGKVEER |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yeeR |
Synonyms | yeeR; b2001; JW1983; Inner membrane protein YeeR |
UniProt ID | P76361 |
◆ Recombinant Proteins | ||
CD86-596M | Recombinant Mouse CD86 Protein | +Inquiry |
MPV17-312HF | Recombinant Full Length Human MPV17 Protein | +Inquiry |
RFL22082SF | Recombinant Full Length Streptomyces Coelicolor Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged | +Inquiry |
S100A1-1909H | Recombinant Human S100A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CAMK1-613R | Recombinant Rhesus monkey CAMK1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-016M | Native Mouse Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
VIM-186B | Native bovine VIM | +Inquiry |
LDH-227H | Active Native Human Lactate Dehydrogenase Total | +Inquiry |
GALT-10 | Active Native Streptoverticillium mobaraense | +Inquiry |
F5-5300H | Native Human Coagulation Factor V (proaccelerin, labile factor) | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLR3K-3020HCL | Recombinant Human POLR3K 293 Cell Lysate | +Inquiry |
Pituitary-726P | Pig Pituitary Lysate, Total Protein | +Inquiry |
DYDC1-6763HCL | Recombinant Human DYDC1 293 Cell Lysate | +Inquiry |
SYT4-1304HCL | Recombinant Human SYT4 293 Cell Lysate | +Inquiry |
HA-2664HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yeeR Products
Required fields are marked with *
My Review for All yeeR Products
Required fields are marked with *
0
Inquiry Basket