Recombinant Full Length Human MPV17 Protein

• Cat.No.: MPV17-312HF
• Product Overview: Recombinant full length Human MPV17 with N terminal proprietary tag; Predicted MWt 45.43 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 176 amino acids
• Description: This gene encodes a mitochondrial inner membrane protein that is implicated in the metabolism of reactive oxygen species. Mutations in this gene have been associated with the hepatocerebral form of mitochondrial DNA depletion syndrome (MDDS).
• Form: Liquid
• Molecular Mass: 45.430kDa inclusive of tags
• AA Sequence: MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVER RGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGT TKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNW AKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQC VAVIWNSYLSWKAHRL
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: MPV17 MpV17 mitochondrial inner membrane protein [ Homo sapiens ]
• Official Symbol: MPV17
• Synonyms: MPV17; MpV17 mitochondrial inner membrane protein; MpV17 transgene, murine homolog, glomerulosclerosis; protein Mpv17;glomerulosclerosis; SYM1
• Gene ID: 4358
• mRNA Refseq: NM_002437
• Protein Refseq: NP_002428
• MIM: 137960
• UniProt ID: P39210