Recombinant Mouse CD86 Protein

• Cat.No.: CD86-596M
• Product Overview: Recombinant Mouse CD86 protein without tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Protein Length: 309
• Description: Predicted to enable signaling receptor binding activity. Involved in several processes, including CD40 signaling pathway; activation of phospholipase C activity; and positive regulation of macromolecule metabolic process. Acts upstream of or within several processes, including cellular response to lipopolysaccharide; defense response to virus; and positive regulation of T cell proliferation. Located in external side of plasma membrane and intracellular membrane-bounded organelle. Is expressed in central nervous system and retina. Used to study Guillain-Barre syndrome. Human ortholog(s) of this gene implicated in several diseases, including Henoch-Schoenlein purpura; autoimmune disease (multiple); chronic lymphocytic leukemia; chronic obstructive pulmonary disease; and systemic scleroderma. Orthologous to human CD86 (CD86 molecule).
• Form: Lyophilized
• Molecular Mass: 27.1 kDa
• AA Sequence: MDPRCTMGLAILIFVTVLLISDAVSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKEITASVTVALLLVMLLIIVCHKKPNQPSRPSNTASKLERDSNADRETINLKELEPQIASAKPNAE
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: Cd86 CD86 antigen [ Mus musculus (house mouse) ]
• Official Symbol: CD86
• Synonyms: CD86; CD86 antigen; T-lymphocyte activation antigen CD86; activation B7-2 antigen; early T cell costimulatory molecule-1; early T-cell costimulatory molecule 1; B7; B70; MB7; B7-2; B7.2; CLS1; Ly58; ETC-1; Ly-58; MB7-2; Cd28l2; TS/A-2
• Gene ID: 12524
• mRNA Refseq: NM_019388
• Protein Refseq: NP_062261
• UniProt ID: P42082