Recombinant Full Length Escherichia Coli Ferrous-Iron Efflux Pump Fief(Fief) Protein, His-Tagged
Cat.No. : | RFL17150EF |
Product Overview : | Recombinant Full Length Escherichia coli Ferrous-iron efflux pump FieF(fieF) Protein (B1XB81) (1-300aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-300) |
Form : | Lyophilized powder |
AA Sequence : | MNQSYGRLVSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVV RYSLQPADDNHSFGHGKAESLAALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVGVIV TIVALICTIILVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLALGLSWYGWHRADA LFALGIGIYILYSALRMGYEAVQSLLDRALPDEERQEIIDIVTSWPGVSGAHDLRTRQSG PTRFIQIHLEMEDSLPLVQAHMVADQVEQAILRRFPGSDVIIHQDPCSVVPREGKRSMLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fieF |
Synonyms | fieF; ECDH10B_4104; Ferrous-iron efflux pump FieF |
UniProt ID | B1XB81 |
◆ Native Proteins | ||
CP-8074M | Native Mouse Serum Ceruloplasmin | +Inquiry |
Chylomicrons-192H | Native Human Chylomicrons | +Inquiry |
PLG-30880TH | Native Human PLG | +Inquiry |
MB-8226H | Native Human Heart Myoglobin | +Inquiry |
Lectin-1860W | Active Native Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAMTS10-9032HCL | Recombinant Human ADAMTS10 293 Cell Lysate | +Inquiry |
ADSS-8994HCL | Recombinant Human ADSS 293 Cell Lysate | +Inquiry |
RNH1-2268HCL | Recombinant Human RNH1 293 Cell Lysate | +Inquiry |
DNAJB7-6882HCL | Recombinant Human DNAJB7 293 Cell Lysate | +Inquiry |
PTH1R-1841HCL | Recombinant Human PTH1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fieF Products
Required fields are marked with *
My Review for All fieF Products
Required fields are marked with *
0
Inquiry Basket