Recombinant Full Length Emericella Nidulans Ph-Response Regulator Protein Pali/Rim9(Pali) Protein, His-Tagged
Cat.No. : | RFL21008EF |
Product Overview : | Recombinant Full Length Emericella nidulans pH-response regulator protein palI/RIM9(palI) Protein (O93956) (1-549aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Emericella nidulans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-549) |
Form : | Lyophilized powder |
AA Sequence : | MLLKPATPLTILLLIAFVLLLLSVISTPIVKSIPLATFDNVEYGVFGYCKAGTCTAIHIG YTTEEIENTGSTDSDFNLPSDARRSLSSILIVHPIAAFLTLICLCLAAAAHLHAPSHSPR YLLALLILLLPTLLVSLLAFLVDILLFVPHLSWGGWIVLAATIILVTCGVVTCAMRRTLV SRKARKRRIAENAEMSGQNYYNRQNAAAAALNESKPIAPEAKETFVAATQSSESGPTFAT FRTNTRSSDDDRTPLNNHSDPSAQDAGYQSRIPGDPVPYNAPRDDFGNPLPPGAYNSAPR MRTPGPPGPPPPDSRVRDQYSDPRRGPPTGFAPRGRGGYPPRGGYGRGGPYGGPYGPNSR APLTGRGGYMGPMRGGPAGPMARGGYRPQPAAGGYGNARAMGEDEYGYRGPSSRQRTPGP MAAPAAPGPAGQAIEMMPQPRHEPDAQDEVPEQQQLHAISIDNQHEPVSPTSLYSRTQSY VPPRRNWGPQAYQSSEPNLPYQPNQPRHARSQSGSMYYEDEDPVYTSRNESAVGNSGVPS VLTPGNSAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | palI |
Synonyms | palI; AN4853; pH-response regulator protein palI/RIM9 |
UniProt ID | O93956 |
◆ Native Proteins | ||
CPB2-8517H | Active Native Human CPB2 | +Inquiry |
Lectin-1744M | Active Native Maclura Pomifera Lectin Protein | +Inquiry |
Fixa-280B | Active Native Bovine Factor IXa - DEGR | +Inquiry |
KNG1-18H | Native Human Kininogen, LMW | +Inquiry |
Lectin-1857V | Active Native Vicia Villosa Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
Thymus-127M | Mouse Thymus Tissue Lysate (7 Days Old) | +Inquiry |
FZR1-6087HCL | Recombinant Human FZR1 293 Cell Lysate | +Inquiry |
PCSK1-2249HCL | Recombinant Human PCSK1 cell lysate | +Inquiry |
PHF21B-3229HCL | Recombinant Human PHF21B 293 Cell Lysate | +Inquiry |
CD84-1733MCL | Recombinant Mouse CD84 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All palI Products
Required fields are marked with *
My Review for All palI Products
Required fields are marked with *
0
Inquiry Basket