Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 64A(Gr64A) Protein, His-Tagged
Cat.No. : | RFL33232DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 64a(Gr64a) Protein (P83293) (1-456aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-456) |
Form : | Lyophilized powder |
AA Sequence : | MKGPNLNFRKTPSKDNGVKQVESLARPETPPPKFVEDSNLEFNVLASEKLPNYTNLDLFH RAVFPFMFLAQCVAIMPLVGIRESNPRRVRFAYKSIPMFVTLIFMIATSILFLSMFTHLL KIGITAKNFVGLVFFGCVLSAYVVFIRLAKKWPAVVRIWTRTEIPFTKPPYEIPKRNLSR RVQLAALAIIGLSLGEHALYQVSAILSYTRRIQMCANITTVPSFNNYMQTNYDYVFQLLP YSPIIAVLILLINGACTFVWNYMDLFIMMISKGLSYRFEQITTRIRKLEHEEVCESVFIQ IREHYVKMCELLEFVDSAMSSLILLSCVNNLYFVCYQLLNVFNKLRWPINYIYFWYSLLY LIGRTAFVFLTAADINEESKRGLGVLRRVSSRSWCVEVERLIFQMTTQTVALSGKKFYFL TRRLLFGMAGTIVTYELVLLQFDEPNRRKGLQPLCA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr64a |
Synonyms | Gr64a; CG32261; Gustatory receptor for sugar taste 64a |
UniProt ID | P83293 |
◆ Recombinant Proteins | ||
RBP1-2744H | Recombinant Human RBP1 Protein (Asp64-Gln197), His tagged | +Inquiry |
FOLH1-3433P | Recombinant Pig FOLH1 protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
TNFRSF8-642HAF555 | Recombinant Human TNFRSF8 Protein, Fc/His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
FAM98A-4656HF | Recombinant Full Length Human FAM98A Protein, GST-tagged | +Inquiry |
CANT1-1209M | Recombinant Mouse CANT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
FGG -57R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
GSN-874P | Active Native Porcine GSN Protein | +Inquiry |
Prothrombin-4S | Native Snake E. Carinatus Viper Venom Prothrombin Activator | +Inquiry |
Complement C3c-49H | Native Human Complement C3c | +Inquiry |
RO60-16C | Native Cattle RO60 Protein, Biotinlyated | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEF6-6993HCL | Recombinant Human DEF6 293 Cell Lysate | +Inquiry |
PUS10-2661HCL | Recombinant Human PUS10 293 Cell Lysate | +Inquiry |
COL6A5-646HCL | Recombinant Human COL6A5 cell lysate | +Inquiry |
TADA3-1279HCL | Recombinant Human TADA3 293 Cell Lysate | +Inquiry |
EPYC-6572HCL | Recombinant Human EPYC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr64a Products
Required fields are marked with *
My Review for All Gr64a Products
Required fields are marked with *
0
Inquiry Basket