Recombinant Full Length Emericella Nidulans Palmitoyltransferase Pfa3(Pfa3) Protein, His-Tagged
Cat.No. : | RFL29356EF |
Product Overview : | Recombinant Full Length Emericella nidulans Palmitoyltransferase pfa3(pfa3) Protein (C8VCL4) (1-514aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Emericella nidulans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-514) |
Form : | Lyophilized powder |
AA Sequence : | MATLAMSTPSSPTWPKRRPKAWAMRCERYCCAAASYFPLAFVYSLTTWAVYVEASVGLKP SSSSWIGLPSSILGVVLYLALNISYTTAVFTDPGSPLGARSGGGHPYSALPITELPEYTS YTVNSTGGSRFCKKCQCPKPDRAHHCSTCKRCVLKMDHHCPWLATCVGLRNYKAFLLFLI YTSLFCWVDFGVSAIWIWTEVFNDTRYMDGILPVNVVLLSILGGIIGLVLTGFTAWHISL ATRGLTTIECLEKTRYVSPLRKALDRHRYDGLLGTNTGGENQDTFGSRLQNYGNQILDAH ANAIPGVTRPEEGEESSDNLTPAQQALSRSYADLERQREHDRYEDYLAELDNEKMPHAFD LGWKRNLLHLFGDRPLHWLVPTPTTTGNGWEWEPSRKFLEAQERVRQQREQVAEQQRQHQ RDLYLRNMNNSRAWLGNELPPGWTPDQPLSHSDDVARPATGVSMKTLAPRSPRPRPGEEV YAEDLDKDDFVLEPTRGKGSGNQSSREDDWRDWD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pfa3 |
Synonyms | pfa3; AN10934; Palmitoyltransferase pfa3; Protein fatty acyltransferase 3 |
UniProt ID | C8VCL4 |
◆ Recombinant Proteins | ||
SLC35C1-4443C | Recombinant Chicken SLC35C1 | +Inquiry |
MDO-1556M | Recombinant Mycobacterium sp. MDO Protein (M1-Y423) | +Inquiry |
TTC33-7148H | Recombinant Human Tetratricopeptide Repeat Domain 33, His-tagged | +Inquiry |
RFL30916AF | Recombinant Full Length Arabidopsis Thaliana Long-Chain-Alcohol Oxidase Fao4B(Fao4B) Protein, His-Tagged | +Inquiry |
UGT2A4-7714Z | Recombinant Zebrafish UGT2A4 | +Inquiry |
◆ Native Proteins | ||
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
Collagen-55B | Native Bovine Collagen Type II | +Inquiry |
GFAP-526H | Native Human GFAP protein | +Inquiry |
TcdB-189C | Active Native Clostridium difficile Toxin B Protein | +Inquiry |
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLCA2-7478HCL | Recombinant Human CLCA2 293 Cell Lysate | +Inquiry |
CDR2-7607HCL | Recombinant Human CDR2 293 Cell Lysate | +Inquiry |
CLK3-697HCL | Recombinant Human CLK3 cell lysate | +Inquiry |
INTS7-865HCL | Recombinant Human INTS7 cell lysate | +Inquiry |
YARS-249HCL | Recombinant Human YARS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pfa3 Products
Required fields are marked with *
My Review for All pfa3 Products
Required fields are marked with *
0
Inquiry Basket