Recombinant Full Length Neosartorya Fumigata Palmitoyltransferase Pfa3(Pfa3) Protein, His-Tagged
Cat.No. : | RFL35834NF |
Product Overview : | Recombinant Full Length Neosartorya fumigata Palmitoyltransferase pfa3(pfa3) Protein (Q4WZL8) (1-548aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neosartorya fumigata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-548) |
Form : | Lyophilized powder |
AA Sequence : | MMATLATSPPTSPTWPKRRPRAWALRCERYCCAAATYFPLAFVYSLTTWAVYVEASIGLK PSRSPWIGLPTSILGVLLYICLNASYTVAVFTDPGSPLTTGAGRHQYSALPVSELPEYTA YTVSSTGGSRYCKKCQCPKPDRAHHCSTCKRCVLKMDHHCPWLATCVGLYNYKAFLLFLI YTSLFCWVDFAVSATWIWTEVFNDAPYLETMLPVNVVLLAILGGIIGLVLTGFTAWHISL AVRGMTTIECLEKTRYVSPLRKALDRHRYEHILGNHRDGNRASPVADSFGHRLQDYGQQI LDAHANAIPGVTRAEEGEERLSPAPEQPASHGVSDDQLTPAQQALTRSYAELERQREHDR YQDYLNEEDNGKLPHAFDLGWRRNLLHLFGNRPLLWLIPVCTTTGDGWRWEPSRKFLEAQ EGLRLKREQDMANQQHYYRDLYSRNMNNGRAWLGPNAAAPTWNPHQPLDSFRDPERPATG VSMRTLAPMSPRPRPGDSDFEDDISETDPLNQQSVPANGAVNQLQKANEASSATTNRRED SSEWRDWD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pfa3 |
Synonyms | pfa3; AFUA_2G16480; Palmitoyltransferase pfa3; Protein fatty acyltransferase 3 |
UniProt ID | Q4WZL8 |
◆ Recombinant Proteins | ||
RFL18788NF | Recombinant Full Length Nitrosomonas Europaea Probable Intracellular Septation Protein A(Ne0055) Protein, His-Tagged | +Inquiry |
ACTG1-819HF | Recombinant Full Length Human ACTG1 Protein, GST-tagged | +Inquiry |
KLKB1-8757M | Recombinant Mouse KLKB1 Protein | +Inquiry |
TOMM7-7506Z | Recombinant Zebrafish TOMM7 | +Inquiry |
DKK3-685H | Recombinant Human DKK3 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
Lectin-1784G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, DyLight 649 Labeled | +Inquiry |
Ferritin-024B | Native Bovine Ferritin Protein, holo form | +Inquiry |
a-AntiTrypsin-5911H | Active Native Human a-AntiTrypsin | +Inquiry |
TF-8273H | Native Human Serum Transferrin HOLO(iron-saturated) | +Inquiry |
◆ Cell & Tissue Lysates | ||
THG1L-1096HCL | Recombinant Human THG1L 293 Cell Lysate | +Inquiry |
IRX4-5156HCL | Recombinant Human IRX4 293 Cell Lysate | +Inquiry |
DEFB126-6982HCL | Recombinant Human DEFB126 293 Cell Lysate | +Inquiry |
CHI3L1-1715MCL | Recombinant Mouse CHI3L1 cell lysate | +Inquiry |
IL12A & IL12B-1779MCL | Recombinant Mouse IL12A & IL12B Overexpression Lysate(Met 1-Ala 215&Met 1-Ser 335) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pfa3 Products
Required fields are marked with *
My Review for All pfa3 Products
Required fields are marked with *
0
Inquiry Basket