Recombinant Full Length Yarrowia Lipolytica Palmitoyltransferase Pfa3(Pfa3) Protein, His-Tagged
Cat.No. : | RFL17599YF |
Product Overview : | Recombinant Full Length Yarrowia lipolytica Palmitoyltransferase PFA3(PFA3) Protein (Q6C4W5) (1-401aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yarrowia lipolytica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-401) |
Form : | Lyophilized powder |
AA Sequence : | MQCRKCCFACEKWCFIGAKAFLPLVVNFLIIWACWVHAWLVCWEPQLFESDTTFWRVYGV AGVAIGIMCNVLYLKVCKVGPGSPTDIDNFSVPLVEYQNACSAEGQHLTPPREMANSVCA KENGGLRFCTKCIGWKPDRSHHCSNYKRCVLKFDHYCPWFATAIGFHNHKYFVLFLWYVT ILCFFCLGSTGFVFYNHILEIGAMRGPDGNTDYVGAISVNVMILMVLALVFAIAVGTFAT FSLYLVFNNQSTVEFLESTQYRSAVPTAAYRYTFAPTSKTVGNVFDVGWKRNFQLVMGDK WWMWLLPIQPSEAARGNGTQFPLNKQVLQKIREAAAKEVQIRDQNQAYIKQQRQQQQKRT QYDLPQHLQPPPQEHYEYDDEAQDSGDDIPLINMVNKNNTK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PFA3 |
Synonyms | PFA3; YALI0E23177g; Palmitoyltransferase PFA3; Protein fatty acyltransferase 3 |
UniProt ID | Q6C4W5 |
◆ Recombinant Proteins | ||
PSMF1-31210TH | Recombinant Human PSMF1, His-tagged | +Inquiry |
IOLC-0933B | Recombinant Bacillus subtilis IOLC protein, His-tagged | +Inquiry |
CXCL10-71M | Recombinant Mouse CXCL10 (IP-10) | +Inquiry |
CDO1-928H | Recombinant Human CDO1 Protein, His-tagged | +Inquiry |
TDP2-16603M | Recombinant Mouse TDP2 Protein | +Inquiry |
◆ Native Proteins | ||
MG-41H | Active Native Human MG | +Inquiry |
C3d-48HB | Native Human Complement C3d Protein, Biotinylated | +Inquiry |
MPOA-233H | Native Human Myeloperoxidase Isoform A | +Inquiry |
Neuraminidase-007C | Active Native Clostridium perfringens Neuraminidase, Type X | +Inquiry |
Calmodulin-016 | Native Calmodulin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Stomach-851P | Pig Stomach Membrane Lysate, Total Protein | +Inquiry |
ARTN-134HCL | Recombinant Human ARTN cell lysate | +Inquiry |
DMKN-1968HCL | Recombinant Human DMKN cell lysate | +Inquiry |
FABP7-6474HCL | Recombinant Human FABP7 293 Cell Lysate | +Inquiry |
GAL3ST1-6046HCL | Recombinant Human GAL3ST1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PFA3 Products
Required fields are marked with *
My Review for All PFA3 Products
Required fields are marked with *
0
Inquiry Basket