Recombinant Full Length Ectocarpus Siliculosus Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL32106EF |
Product Overview : | Recombinant Full Length Ectocarpus siliculosus ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (D1J722) (1-661aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ectocarpus siliculosus (Brown alga) (Conferva siliculosa) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-661) |
Form : | Lyophilized powder |
AA Sequence : | MKNQTTKNIILVFVGLALLSGFVYLKWDNFTDVGTNLINLKNSHPTQMVSYDTFLHYLEN GAIKKVDLYENAELAVFDAFESLDQNLLKPVPLLSSDTLFGILNSDEFRPIGVKIPVRNS SLILTLRDYKIDFTAYPIVNFDSIWPILSVLLIPVLLIVVYRLFFSEGSNYDFFGNLRKA RAKIQLDADTGVLFSDVAGIDEAKQEFEEFVSFLKMPQLFTAVGANPPKGVIIVGPPGTG KTLLAKAIAGEAGVPFISISGSEFVEMFVGIGASRVRDLFETAERNSPCILFIDEIDAIG RQRGTGVGGTNDEREQTLNQILTEMDGFKPTSGIIVIAATNRADVLDSALLRPGRFDRQI TVYLPNIYGRIEILKVHSRNKNIDSKTSLKFIAQRTAGFSGADLANILNEAAILTARANL ETITIKQIYTAIERIIAGLEGVLLNDSRNKRLVAYHEVGHALTGTLLKNHDDVQKVTLIP RGRAQGLTWFTPDEQPLMTRGQLSSRLIGTLGGRAAEKVIFGKMEITSGASNDFFKVNSL ARQMVTRFGMSSLTPMAMELPKPTIFFGRSVQTRPDCFLDIADKIDLQIIEMVEDGFEKA CITLERNRLLLDQLATLLTQIETIDGKEFEQFVSTYTGLPKKPQLKIVKAKENKNKVKAP V |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; Es_cpDNA_67; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | D1J722 |
◆ Recombinant Proteins | ||
RFL1BF | Recombinant Full Length Breda Virus 1 Membrane Protein(M) Protein, His-Tagged | +Inquiry |
RFL10744IF | Recombinant Full Length Influenza B Virus Glycoprotein Nb(Nb) Protein, His-Tagged | +Inquiry |
Aicda-1566M | Recombinant Mouse Aicda protein | +Inquiry |
RFL34427SF | Recombinant Full Length Putative Antiporter Subunit Mnhf2(Mnhf2) Protein, His-Tagged | +Inquiry |
FAHD2A-2199R | Recombinant Rat FAHD2A Protein | +Inquiry |
◆ Native Proteins | ||
CTSG-5327H | Native Human Cathepsin G | +Inquiry |
TNNI3-01H | Native Human TNNI3 Protein | +Inquiry |
PHAL-01P | Active Native Phaseolus vulgaris lectin L Protein | +Inquiry |
Lectin-1769D | Active Native Dolichos Biflorus Agglutinin Protein, Biotinylated | +Inquiry |
MYS-01R | Active Native Rabbit Heavy Meromyosin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSBPL7-3532HCL | Recombinant Human OSBPL7 293 Cell Lysate | +Inquiry |
VAV1-423HCL | Recombinant Human VAV1 293 Cell Lysate | +Inquiry |
Ileum-247H | Human Ileum Lysate | +Inquiry |
PATZ1-3421HCL | Recombinant Human PATZ1 293 Cell Lysate | +Inquiry |
C19orf21-8215HCL | Recombinant Human C19orf21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket