Recombinant Full Length Drosophila Simulans Transmembrane Gtpase Fzo(Fzo) Protein, His-Tagged
Cat.No. : | RFL25614DF |
Product Overview : | Recombinant Full Length Drosophila simulans Transmembrane GTPase fzo(fzo) Protein (Q9N6P4) (1-454aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila simulans (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-454) |
Form : | Lyophilized powder |
AA Sequence : | SSMEPEMEQKVKDQHMERCVNLLVDELGVYSTAQEAWERIYHVSALEALHIRNGHIKNPS AQTKERYQEFLRFENDFSNCLAVSALKTKFGPHLLSAQKILNQLKSTLISPFIEKVSRLI DENKERRANLNAEIEEWELEMQDEREDLQYCFEELTEMTQRLGRCVLNDQIKTLIPSAVL SFSHPFHPEFPAQIGQYQRSLCAHLDNLLEDRVLQCLSIPLQRKILDMEKELGLQITEKS CDWQLIYGLDCQSYMSDFQPDLRFRFSLGFTALWHRLEGNLPLHSSPFRTQKLRNGHKKC LPLPPLVHGNHWQMLESLVKSKGSLGTVLLGAMAIRSFNWPIVMILGGLVGSFYMYEYAA WTTAAQERSFKSQYSRLLQQRLRTDVQQTVSGFELQLRQHLAKVRNCWEAQSNETLNDLN VRTAELTKQIQSMEVLQLSLKKFRDKGQLLASRL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fzo |
Synonyms | fzo; Transmembrane GTPase fzo; Protein fuzzy onions; Fragment |
UniProt ID | Q9N6P4 |
◆ Native Proteins | ||
Lectin-1785G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, Fluorescein labeled | +Inquiry |
ALB-20H | Native Human Serum Albumin Protein | +Inquiry |
PRTN3-01H | Native Human PRTN3 Protein | +Inquiry |
SERPINA3-5331H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 3 | +Inquiry |
CFD-348H | Active Native Human Factor D | +Inquiry |
◆ Cell & Tissue Lysates | ||
APEX1-8797HCL | Recombinant Human APEX1 293 Cell Lysate | +Inquiry |
MOB3C-1125HCL | Recombinant Human MOB3C cell lysate | +Inquiry |
HAAO-5650HCL | Recombinant Human HAAO 293 Cell Lysate | +Inquiry |
PEX14-1336HCL | Recombinant Human PEX14 cell lysate | +Inquiry |
LOXL2-1854HCL | Recombinant Human LOXL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fzo Products
Required fields are marked with *
My Review for All fzo Products
Required fields are marked with *
0
Inquiry Basket