Recombinant Full Length Drosophila Pseudoobscura Pseudoobscura Opsin Rh2(Rh2) Protein, His-Tagged
Cat.No. : | RFL14099DF |
Product Overview : | Recombinant Full Length Drosophila pseudoobscura pseudoobscura Opsin Rh2(Rh2) Protein (P28679) (1-381aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila pseudoobscura pseudoobscura (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-381) |
Form : | Lyophilized powder |
AA Sequence : | MERSLLPEPPLAMALLGPRFEAQTGGNRSVLDNVLPDMAPLVNPYWSRFAPMDPTMSKIL GLFTLVILIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYY ETWVLGPLWCDIYAACGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKIAFI WMMAVFWTIMPLIGWSSYVPEGNLTACSIDYMTRQWNPRSYLITYSLFVYYTPLFMICYS YWFIIATVAAHEKAMRDQAKKMNVKSLRSSEDCDKSAENKLAKVALTTISLWFMAWTPYL IICYFGLFKIDGLTPLTTIWGATFAKTSAVYNPIVYGISHPKYRLVLKEKCPMCVCGSTD EPKPDAPPSDTETTSEAESKA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rh2 |
Synonyms | Rh2; GA14120; Opsin Rh2; Ocellar opsin |
UniProt ID | P28679 |
◆ Native Proteins | ||
Ferrous Hemoglobin-033H | Native Human Ferrous Hemoglobin Protein | +Inquiry |
LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
LTF-3211B | Native Bovine Lactoferrin Protein | +Inquiry |
APOB-8037H | Native Human Plasma APOB | +Inquiry |
IGHG3-231H | Native Human Immunoglobulin G3 (IgG3) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SK-BR-3-1611H | SK-BR-3 (human breast adenocarcinoma) nuclear extract lysate | +Inquiry |
CES5A-7563HCL | Recombinant Human CES7 293 Cell Lysate | +Inquiry |
ZNF18-133HCL | Recombinant Human ZNF18 293 Cell Lysate | +Inquiry |
FUZ-6110HCL | Recombinant Human FUZ 293 Cell Lysate | +Inquiry |
GPR143-739HCL | Recombinant Human GPR143 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rh2 Products
Required fields are marked with *
My Review for All Rh2 Products
Required fields are marked with *
0
Inquiry Basket