Recombinant Full Length Human NEUROD6 Protein, Strep tagged

• Cat.No.: NEUROD6-23HFL
• Product Overview: Recombinant Human NEUROD6 Protein, Full Length with Strep tag was expressed in Tobacco (Nicotiana tabacum).

Specification

• Species: Human
• Source: Tobacco
• Tag: Strep
• Protein Length: Full Length
• Description: This gene is a member of the NEUROD family of basic helix-loop-helix transcription factors. The encoded protein may be involved in the development and differentiation of the nervous system.
• Tag: Strep
• Form: Liquid
• Molecular Mass: 38.7 kDa
• AA Sequence: MLTLPFDESVVMPESQMCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEEEEEDREEEDENGLPRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDLLTFVQNLCKGLSQPTTNLVAGCLQLNARSFLMGQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMHYCAVPPRGPLGQGAMFRLPTDSHFPYDLHLRSQSLTMQDELNAVFHN
  Sequence without tag.
• Endotoxin: Low Endotoxin less than 1 EU/mg (< 0.1 ng/mg)
• Purity: >80 % as determined by SDS PAGE, Size Exclusion Chromatography and Western Blot.
• Applications: Western Blotting (WB), ELISA, SDS-PAGE (SDS)
• Handling: Avoid repeated freeze-thaw cycles.
• Storage: At -80 centigrade

Gene Information

• Gene Name: NEUROD6 neuronal differentiation 6 [ Homo sapiens (human) ]
• Official Symbol: NEUROD6
• Synonyms: NEUROD6; neuronal differentiation 6; Nex1; Atoh2; MATH2; NEX1M; Math-2; bHLHa2; neurogenic differentiation factor 6; brain my051 protein; class A basic helix-loop-helix protein 2; protein atonal homolog 2
• Gene ID: 63974
• mRNA Refseq: NM_022728
• Protein Refseq: NP_073565
• MIM: 611513
• UniProt ID: Q96NK8