Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 39B(Gr39B) Protein, His-Tagged
Cat.No. : | RFL7154DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 39b(Gr39b) Protein (P58960) (1-369aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-369) |
Form : | Lyophilized powder |
AA Sequence : | MLYSFHPYLKYFALLGLVPWSESCAQSKFVQKVYSAILIILNAVHFGISIYFPQSAELFL SLMVNVIVFVARIVCVTVIILQVMVHYDDYFRFCREMKYLGLRLQCELKIHVGRLKWQSY AKILALGIGFLVTVLPSIYVALSGSLLYFWSSLLSILIIRMQFVLVLLNVELLGHHVSLL GIRLQNVLECHLMGANCTLDGNANRLCSLEFLLALKQSHMQLHYLFTHFNDLFGWSILGT YVVLFSDSTVNIYWTQQVLVEVYEYKYLYATFSVFVPSFFNILVFCRCGEFCQRQSVLIG SYLRNLSCHPSIGRETSYKDLLMEFILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYL IVLMQFSSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr39b |
Synonyms | Gr39b; GR39D.1; CG31620; Putative gustatory receptor 39b |
UniProt ID | P58960 |
◆ Recombinant Proteins | ||
RFL32416HF | Recombinant Human Cysteinyl Leukotriene Receptor 1(Cysltr1) Protein, His-Tagged | +Inquiry |
MUC12-3543H | Recombinant Human MUC12 Protein, His (Fc)-Avi-tagged | +Inquiry |
Mitd1-4081M | Recombinant Mouse Mitd1 Protein, Myc/DDK-tagged | +Inquiry |
Thpo-6418M | Active Recombinant Mouse Thpo Protein | +Inquiry |
SARNP-1370H | Recombinant Human SARNP Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
GGT1-8131H | Native Human Liver Gamma Glutamyl Transpeptidase | +Inquiry |
Transglutaminase-88G | Active Native Guinea pig liver Transglutaminase | +Inquiry |
CTLGV2EB-359C | Active Native Chlamydia trachomatis LGV Type-2 EB Protein | +Inquiry |
Lectin-1760A | Active Native Agaricus bisporus lectin Protein | +Inquiry |
Factor 4-88H | Native Human Platelet Factor 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSM7-9170HCL | Recombinant Human LSM7 293 Cell Lysate | +Inquiry |
ATG4D-45HCL | Recombinant Human ATG4D lysate | +Inquiry |
NR0B2-3722HCL | Recombinant Human NR0B2 293 Cell Lysate | +Inquiry |
WDR38-349HCL | Recombinant Human WDR38 293 Cell Lysate | +Inquiry |
SPERT-628HCL | Recombinant Human SPERT lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Gr39b Products
Required fields are marked with *
My Review for All Gr39b Products
Required fields are marked with *
0
Inquiry Basket