Active Recombinant Mouse Thpo Protein

• Cat.No.: Thpo-6418M
• Product Overview: Purified recombinant protein of Mouse thrombopoietin (Thpo), transcript variant 2 without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: This gene encodes a humoral growth factor necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. The encoded protein is a ligand for the product of the myeloproliferative leukemia virus oncogene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
• Bio-activity: The ED50 was determined by the dose-dependent stimulation of the proliferation of human MO7e cells was found to be > 1.0 ng/mL, corresponding to a specific activity of > 1 × 10^6 units/mg.
• Molecular Mass: 18.7 kDa
• AA Sequence: SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKF
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2

Gene Information

• Gene Name: Thpo thrombopoietin [ Mus musculus (house mouse) ]
• Official Symbol: Thpo
• Synonyms: THPO; thrombopoietin; C-mpl ligand; megakaryocyte colony-stimulating factor; megakaryocyte growth and development factor; myeloproliferative leukemia virus oncogene ligand; Ml; Tpo; Mgdf; Tpo1; Tpo2; Tpo3; Tpo4; Mpllg
• Gene ID: 21832
• mRNA Refseq: NM_009379
• Protein Refseq: NP_033405
• UniProt ID: P40226