Recombinant Full Length Drosophila Melanogaster Odorant Receptor 22A(Or22A) Protein, His-Tagged
Cat.No. : | RFL35578DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Odorant receptor 22a(Or22a) Protein (P81909) (1-397aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-397) |
Form : | Lyophilized powder |
AA Sequence : | MLSKFFPHIKEKPLSERVKSRDAFIYLDRVMWSFGWTEPENKRWILPYKLWLAFVNIVML ILLPISISIEYLHRFKTFSAGEFLSSLEIGVNMYGSSFKCAFTLIGFKKRQEAKVLLDQL DKRCLSDKERSTVHRYVAMGNFFDILYHIFYSTFVVMNFPYFLLERRHAWRMYFPYIDSD EQFYISSIAECFLMTEAIYMDLCTDVCPLISMLMARCHISLLKQRLRNLRSKPGRTEDEY LEELTECIRDHRLLLDYVDALRPVFSGTIFVQFLLIGTVLGLSMINLMFFSTFWTGVATC LFMFDVSMETFPFCYLCNMIIDDCQEMSNCLFQSDWTSADRRYKSTLVYFLHNLQQPITL TAGGVFPISMQTNLAMVKLAFSVVTVIKQFNLAERFQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or22a |
Synonyms | Or22a; AN11; DOR22A.1; dor53; Or22A.1; CG12193; Odorant receptor 22a |
UniProt ID | P81909 |
◆ Native Proteins | ||
LTF-230B | Native Bovine Apo-Lactoferrin | +Inquiry |
C3-147C | Active Native Botulinum C3 Enzyme | +Inquiry |
IGHD -20H | Native Human IgD | +Inquiry |
Thrombin-24H | Active Native Human a-Thrombin | +Inquiry |
SAP6-91 | Active Native Saponaria Officinalis SAP6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM13-795HCL | Recombinant Human TRIM13 293 Cell Lysate | +Inquiry |
LMO4-4707HCL | Recombinant Human LMO4 293 Cell Lysate | +Inquiry |
EFHB-6702HCL | Recombinant Human EFHB 293 Cell Lysate | +Inquiry |
TLR2-001RCL | Recombinant Rat TLR2 cell lysate | +Inquiry |
ABHD8-9130HCL | Recombinant Human ABHD8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or22a Products
Required fields are marked with *
My Review for All Or22a Products
Required fields are marked with *
0
Inquiry Basket