Recombinant Full Length Drosophila Grimshawi Adenosine Monophosphate-Protein Transferase Ficd Homolog (Gh10751) Protein, His-Tagged
Cat.No. : | RFL21656DF |
Product Overview : | Recombinant Full Length Drosophila grimshawi Adenosine monophosphate-protein transferase FICD homolog (GH10751) Protein (B4JBN5) (1-483aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-483) |
Form : | Lyophilized powder |
AA Sequence : | METGKVTQEPKQMKFTYRFAFFFIAGSLATFVFHALTSSSSVSLFGWRLQLRQLHHLPTA HYLQTRDEFAVYSVDELNAFKEFYDKSVSDSVGASYTEAEQTNIKEALGAMRLALDMHIS GKDDKAARLFEHALALAPKHPEVLLRYGEFLEHNQRNIVLADQYYFQALSISPSNSEAFA NRQRTANVVQTLDERRLVSLDEKRDALSAIHEANAALRRAKKEAYFQHIYHSVGIEGNTM TLAQTRSVLETRMAVDGKSIDEHNEILGMDLAMKYINASLVQKLEITLKDILELHRRVLG HVDPIEGGEFRRTQVYVGGHVPPGPGDLALLMQRFEHWLNSEQSNSLHPVNYAALAHYKL VHIHPFIDGNGRTSRLLMNTLLMRAGYPPVIIPKQQRSQYYHFLKLANEGDIRPFVRFIA DCTEKTLDLYLWATSDLPQQIPMLIQTESEGGVLAQLQSHIAQSAPEPYESGSGLDSGVN GMP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GH10751 |
Synonyms | GH10751; Protein adenylyltransferase Fic; De-AMPylase Fic |
UniProt ID | B4JBN5 |
◆ Recombinant Proteins | ||
COPS4-11461H | Recombinant Human COPS4, GST-tagged | +Inquiry |
Ino80e-3542M | Recombinant Mouse Ino80e Protein, Myc/DDK-tagged | +Inquiry |
THRB-2630H | Recombinant Human THRB protein(11-100 aa), C-His-tagged | +Inquiry |
MYOF-10350M | Recombinant Mouse MYOF Protein | +Inquiry |
RFL27374RF | Recombinant Full Length Rickettsia Typhi Probable Abc Transporter Permease Protein Rt0041(Rt0041) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
CFB-104H | Native Human Factor B | +Inquiry |
LTF-8194H | Native Human Neutrophil Lactoferrin | +Inquiry |
AFP-1180H | Native Human Alpha-Fetoprotein | +Inquiry |
GPD-189R | Active Native Rabbit Glycerol-3-phosphate dehydrogenase | +Inquiry |
Pepsin-27H | Native Human Pepsin (PP) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXM1-6152HCL | Recombinant Human FOXM1 293 Cell Lysate | +Inquiry |
GNL1-5848HCL | Recombinant Human GNL1 293 Cell Lysate | +Inquiry |
OGT-3589HCL | Recombinant Human OGT 293 Cell Lysate | +Inquiry |
IGF2BP2-639HCL | Recombinant Human IGF2BP2 cell lysate | +Inquiry |
PGF-1118MCL | Recombinant Mouse PGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GH10751 Products
Required fields are marked with *
My Review for All GH10751 Products
Required fields are marked with *
0
Inquiry Basket