Recombinant Human THRB protein(11-100 aa), C-His-tagged

Cat.No. : THRB-2630H
Product Overview : Recombinant Human THRB protein(P10828)(11-100 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 11-100 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : LTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQTTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSY
Gene Name THRB thyroid hormone receptor, beta [ Homo sapiens ]
Official Symbol THRB
Synonyms THRB; thyroid hormone receptor, beta; ERBA2, pituitary resistance to thyroid hormone , PRTH, thyroid hormone receptor, beta (avian erythroblastic leukemia viral (v erb a) oncogene homolog 2) , thyroid hormone receptor, beta (erythroblastic leukemia viral (v erb a) oncogene homolog 2, avian); thyroid hormone receptor beta; avian erythroblastic leukemia viral (v erb a) oncogene homolog 2; ERBA BETA; generalized resistance to thyroid hormone; GRTH; NR1A2; oncogene ERBA2; THR1; THRB1; THRB2; thyroid hormone receptor beta 1; nuclear receptor subfamily 1 group A member 2; thyroid hormone nuclear receptor beta variant 1; thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian); PRTH; ERBA2; C-ERBA-2; C-ERBA-BETA; MGC126109; MGC126110;
Gene ID 7068
mRNA Refseq NM_000461
Protein Refseq NP_000452
MIM 190160
UniProt ID P10828

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All THRB Products

Required fields are marked with *

My Review for All THRB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon