Recombinant Human THRB protein(11-100 aa), C-His-tagged

• Cat.No.: THRB-2630H
• Product Overview: Recombinant Human THRB protein(P10828)(11-100 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 11-100 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: LTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQTTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSY

Gene Information

• Gene Name: THRB thyroid hormone receptor, beta [ Homo sapiens ]
• Official Symbol: THRB
• Synonyms: THRB; thyroid hormone receptor, beta; ERBA2, pituitary resistance to thyroid hormone , PRTH, thyroid hormone receptor, beta (avian erythroblastic leukemia viral (v erb a) oncogene homolog 2) , thyroid hormone receptor, beta (erythroblastic leukemia viral (v erb a) oncogene homolog 2, avian); thyroid hormone receptor beta; avian erythroblastic leukemia viral (v erb a) oncogene homolog 2; ERBA BETA; generalized resistance to thyroid hormone; GRTH; NR1A2; oncogene ERBA2; THR1; THRB1; THRB2; thyroid hormone receptor beta 1; nuclear receptor subfamily 1 group A member 2; thyroid hormone nuclear receptor beta variant 1; thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian); PRTH; ERBA2; C-ERBA-2; C-ERBA-BETA; MGC126109; MGC126110
• Gene ID: 7068
• mRNA Refseq: NM_000461
• Protein Refseq: NP_000452
• MIM: 190160
• UniProt ID: P10828