Source :	E. coli
Species :	Human
Tag :	His
Protein length :	11-100 aa
Form :	0.15 M Phosphate buffered saline
AASequence :	LTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQTTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSY
Storage :	Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution :	It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Name	THRB thyroid hormone receptor, beta [ Homo sapiens ]
Official Symbol	THRB
Synonyms	THRB; thyroid hormone receptor, beta; ERBA2, pituitary resistance to thyroid hormone , PRTH, thyroid hormone receptor, beta (avian erythroblastic leukemia viral (v erb a) oncogene homolog 2) , thyroid hormone receptor, beta (erythroblastic leukemia viral (v erb a) oncogene homolog 2, avian); thyroid hormone receptor beta; avian erythroblastic leukemia viral (v erb a) oncogene homolog 2; ERBA BETA; generalized resistance to thyroid hormone; GRTH; NR1A2; oncogene ERBA2; THR1; THRB1; THRB2; thyroid hormone receptor beta 1; nuclear receptor subfamily 1 group A member 2; thyroid hormone nuclear receptor beta variant 1; thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian); PRTH; ERBA2; C-ERBA-2; C-ERBA-BETA; MGC126109; MGC126110;
Gene ID	7068
mRNA Refseq	NM_000461
Protein Refseq	NP_000452
MIM	190160
UniProt ID	P10828