Recombinant Full Length Dog Substance-K Receptor(Tacr2) Protein, His-Tagged
Cat.No. : | RFL26532CF |
Product Overview : | Recombinant Full Length Dog Substance-K receptor(TACR2) Protein (Q5DUB2) (1-384aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-384) |
Form : | Lyophilized powder |
AA Sequence : | MGAHAIVTDANISSSLENNTTGITAFSMPGWQLALWATAYLVLVLVAVTGNATVIWIILA HQRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCHFQNLFPITAMFVS IYSMTAIAADRYVAIVHPFQPRLSAPGTRAVIAGIWLLALALAFPQCFYSTITMDQGATK CVVVWPEDNGSKMLLLYHLVVIALIYVLPLLVMLLAYSVIGLTLWRREVPRHQVHGASLR HLRAKKKFVKTMVLVVVTFAICWLPYHFYFILGSFQEDIYYHKFIQQVYLALFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTEEDKIELTHTPSLSARINRCHTKETFFMA GETALSPATNGQARGPQDGLPDEP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TACR2 |
Synonyms | TACR2; Substance-K receptor; SKR; NK-2 receptor; NK-2R; Neurokinin A receptor; Tachykinin receptor 2 |
UniProt ID | Q5DUB2 |
◆ Recombinant Proteins | ||
Mme-1792M | Recombinant Mouse Mme protein, His & GST-tagged | +Inquiry |
SAP068A-035-1531S | Recombinant Staphylococcus aureus (strain: PM64, other: HA-MRSA) SAP068A_035 protein, His-tagged | +Inquiry |
NI36-RS08455-1032S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS08455 protein, His-tagged | +Inquiry |
PRM1-6003H | Recombinant Human PRM1 Protein (Ala2-His51), N-GST tagged | +Inquiry |
IRX2-162H | Recombinant Human IRX2, His-tagged | +Inquiry |
◆ Native Proteins | ||
FSH-35H | Native Human FSH | +Inquiry |
CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
GGT1-8130H | Native Human Liver Gamma-Glutamyltransferase | +Inquiry |
CPD A-036H | Active Native Human Pancreatic Carboxypeptidase A | +Inquiry |
Mucin-312 | Native Porcine Mucin Type II protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EID1-6682HCL | Recombinant Human EID1 293 Cell Lysate | +Inquiry |
TTC14-688HCL | Recombinant Human TTC14 293 Cell Lysate | +Inquiry |
GLT1D1-715HCL | Recombinant Human GLT1D1 cell lysate | +Inquiry |
CIDEB-7496HCL | Recombinant Human CIDEB 293 Cell Lysate | +Inquiry |
CCDC91-301HCL | Recombinant Human CCDC91 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TACR2 Products
Required fields are marked with *
My Review for All TACR2 Products
Required fields are marked with *
0
Inquiry Basket