Recombinant Full Length Dioscorea Elephantipes Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL2779DF |
Product Overview : | Recombinant Full Length Dioscorea elephantipes Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (A6MMN3) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dioscorea elephantipes (Elephant's foot yam) (Testudinaria elephantipes) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSISGGSITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGLACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS INPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGVGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDVDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPTTVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKIGDPTTRRQAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | A6MMN3 |
◆ Recombinant Proteins | ||
CDAN1-0897H | Recombinant Human CDAN1 Protein, GST-Tagged | +Inquiry |
Kitlg-5252M | Recombinant Mouse Kit Ligand | +Inquiry |
HIST1H3G-4799H | Recombinant Human HIST1H3G Protein, GST-tagged | +Inquiry |
RFL17638PF | Recombinant Full Length Pseudomonas Fluorescens Sulfoxide Reductase Heme-Binding Subunit Yedz(Yedz) Protein, His-Tagged | +Inquiry |
APOE-2541R | Recombinant Rabbit APOE protein, His-SUMO & Myc-tagged | +Inquiry |
◆ Native Proteins | ||
F2-73R | Native Rat Prothrombin | +Inquiry |
C5b6-1537H | Active Native Human C5b,6 Complex Protein | +Inquiry |
SERPINC1-26143TH | Native Human SERPINC1 | +Inquiry |
Vtn-694M | Native Mouse Vitronectin | +Inquiry |
PLD-17S | Active Native Streptomyces chromofuscus Phospholipase D | +Inquiry |
◆ Cell & Tissue Lysates | ||
C14orf126-8289HCL | Recombinant Human C14orf126 293 Cell Lysate | +Inquiry |
MZB1-1029HCL | Recombinant Human MZB1 cell lysate | +Inquiry |
FMO9P-1535HCL | Recombinant Human FMO9P cell lysate | +Inquiry |
C2CD2-238HCL | Recombinant Human C2CD2 cell lysate | +Inquiry |
PITRM1-1357HCL | Recombinant Human PITRM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket