Recombinant Full Length Dictyostelium Discoideum Upf0041 Protein B(Ddb_G0268478) Protein, His-Tagged
Cat.No. : | RFL10397DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum UPF0041 protein B(DDB_G0268478) Protein (Q55GU3) (1-133aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-133) |
Form : | Lyophilized powder |
AA Sequence : | MNALRGLLNKYTGNQIVFSNKYATTFFEKFPKLAFLNNVTNLAPMMKWSLSIVPITQILS GTKLPENIDVYQASSLCATGSIWTYYATLISPQNTGTRMLAACNAAMAACHGYNIYRRTK WEKSQIIPIENKN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DDB_G0268478 |
Synonyms | DDB_G0268478; Probable mitochondrial pyruvate carrier 2; MPC2 |
UniProt ID | Q55GU3 |
◆ Recombinant Proteins | ||
CACUL1-1686HF | Recombinant Full Length Human CACUL1 Protein, GST-tagged | +Inquiry |
CNDP1-1913HF | Recombinant Full Length Human CNDP1 Protein, GST-tagged | +Inquiry |
Pgf-765M | Recombinant Mouse Pgf protein, His & GST-tagged | +Inquiry |
CBX4-2780HF | Recombinant Full Length Human CBX4 Protein, GST-tagged | +Inquiry |
LAG3-674M | Recombinant Mouse LAG3 Protein, IgG2a Fc-tagged | +Inquiry |
◆ Native Proteins | ||
Avidin Biotin-27 | Native Avidin Protein | +Inquiry |
Heartworm-021C | Native Canine Heartworm Antigen | +Inquiry |
GPT-1840H | Active Native Human GPT | +Inquiry |
Lectin-1855V | Active Native Vicia Villosa Lectin Protein, Agarose bound | +Inquiry |
TSHB-704H | Native Human Thyroid Stimulating Hormone, Beta | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMUB2-786HCL | Recombinant Human TMUB2 cell lysate | +Inquiry |
SPINT2-2845MCL | Recombinant Mouse SPINT2 cell lysate | +Inquiry |
ADIPOQ-2209MCL | Recombinant Mouse ADIPOQ cell lysate | +Inquiry |
KPNA1-4892HCL | Recombinant Human KPNA1 293 Cell Lysate | +Inquiry |
COPS5-7356HCL | Recombinant Human COPS5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDB_G0268478 Products
Required fields are marked with *
My Review for All DDB_G0268478 Products
Required fields are marked with *
0
Inquiry Basket