Recombinant Full Length Human CNDP1 Protein, GST-tagged

• Cat.No.: CNDP1-1913HF
• Product Overview: Human CNDP1 full-length ORF ( NP_116038.4, 1 a.a. - 507 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 507 amino acids
• Description: This gene encodes a member of the M20 metalloprotease family. The encoded protein is specifically expressed in the brain, is a homodimeric dipeptidase which was identified as human carnosinase. This gene contains trinucleotide (CTG) repeat length polymorphism in the coding region. [provided by RefSeq, Jul 2008]
• Molecular Mass: 83.1 kDa
• AA Sequence: MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CNDP1 carnosine dipeptidase 1 (metallopeptidase M20 family) [ Homo sapiens ]
• Official Symbol: CNDP1
• Synonyms: CNDP1; carnosine dipeptidase 1 (metallopeptidase M20 family); beta-Ala-His dipeptidase; carnosinase 1; CN1; CPGL2; glutamate carboxypeptidase like protein 2; HsT2308; MGC10825; serum carnosinase; CNDP dipeptidase 1; glutamate carboxypeptidase-like protein 2; MGC102737; MGC142072
• Gene ID: 84735
• mRNA Refseq: NM_032649
• Protein Refseq: NP_116038
• MIM: 609064
• UniProt ID: Q96KN2