Recombinant Full Length Dictyostelium Discoideum Sterol-4-Alpha-Carboxylate 3-Dehydrogenase, Decarboxylating(Nsdhl) Protein, His-Tagged
Cat.No. : | RFL31198DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating(nsdhl) Protein (Q54L85) (1-328aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-328) |
Form : | Lyophilized powder |
AA Sequence : | MKNVFLTGGSGFLGKYIIEELISNGYKVFALSRSETSNKVLSQMGATPVMSSLHDEQGLT EAIKGCDIVIHCAAKLETNSESVQELYKDNIDATELLFNICNQSSTSSVSVFCFISSEGV IMNGENINNATEDTPYPPIEQLGWYNKSKAISEQFLLATQSSMSRMKTIVIRLPLVWGSR DNVLDYLVGLCNKFQWFWIGGGKNYLSIVHAKNASYGIRLAIEKGDNQDIFHLTDGESVQ YRKFFTDRFKKKGVSTNKLHMVLPTPIALSLVWIMALIWKLFNLKGLPLLTKTGLIYSSK NFTINDDKARLKLGYTNKINYNQGMDEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nsdhl |
Synonyms | nsdhl; DDB_G0286833; Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating |
UniProt ID | Q54L85 |
◆ Recombinant Proteins | ||
SSP-RS10055-0262S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS10055 protein, His-tagged | +Inquiry |
Echdc3-2718M | Recombinant Mouse Echdc3 Protein, Myc/DDK-tagged | +Inquiry |
OPRL1-11628Z | Recombinant Zebrafish OPRL1 | +Inquiry |
ADAM10-7638H | Recombinant Human ADAM10 protein, His-tagged | +Inquiry |
RAB1B-684H | Recombinant Human RAB1B Protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
HBA2-27786TH | Native Human HBA2 | +Inquiry |
MMP9-29698TH | Native Human MMP9 | +Inquiry |
IgG-336S | Native Sheep Gamma Globulin Fraction | +Inquiry |
S100AA-258B | Native Bovine S-100αα Protein | +Inquiry |
CTSH-190H | Active Native Human Cathepsin H | +Inquiry |
◆ Cell & Tissue Lysates | ||
SASS6-1562HCL | Recombinant Human SASS6 cell lysate | +Inquiry |
LATS2-4813HCL | Recombinant Human LATS2 293 Cell Lysate | +Inquiry |
ZNF561-50HCL | Recombinant Human ZNF561 293 Cell Lysate | +Inquiry |
RNF8-2271HCL | Recombinant Human RNF8 293 Cell Lysate | +Inquiry |
Spleen-471R | Rhesus monkey Spleen Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nsdhl Products
Required fields are marked with *
My Review for All nsdhl Products
Required fields are marked with *
0
Inquiry Basket