Recombinant Full Length Human Sterol-4-Alpha-Carboxylate 3-Dehydrogenase, Decarboxylating(Nsdhl) Protein, His-Tagged
Cat.No. : | RFL3668HF |
Product Overview : | Recombinant Full Length Human Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating(NSDHL) Protein (Q15738) (1-373aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-373) |
Form : | Lyophilized powder |
AA Sequence : | MEPAVSEPMRDQVARTHLTEDTPKVNADIEKVNQNQAKRCTVIGGSGFLGQHMVEQLLAR GYAVNVFDIQQGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCASPPPSSNNKELFYRV NYIGTKNVIETCKEAGVQKLILTSSASVIFEGVDIKNGTEDLPYAMKPIDYYTETKILQE RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGNGKNLVDFTFV ENVVHGHILAAEQLSRDSTLGGKAFHITNDEPIPFWTFLSRILTGLNYEAPKYHIPYWVA YYLALLLSLLVMVISPVIQLQPTFTPMRVALAGTFHYYSCERAKKAMGYQPLVTMDDAME RTVQSFRHLRRVK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NSDHL |
Synonyms | NSDHL; H105E3; Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating; Protein H105e3 |
UniProt ID | Q15738 |
◆ Native Proteins | ||
TRIM21-212B | Native Cow TRIM21 | +Inquiry |
Cp-048R | Native Rat Ceruloplasmin | +Inquiry |
PLG-27842TH | Native Human PLG | +Inquiry |
IgG2-229H | Native Human Immunoglobulin G2 (IgG2) | +Inquiry |
TFRC-249H | Native Human Transferrin Receptor | +Inquiry |
◆ Cell & Tissue Lysates | ||
RDX-2433HCL | Recombinant Human RDX 293 Cell Lysate | +Inquiry |
WFDC2-2056HCL | Recombinant Human WFDC2 cell lysate | +Inquiry |
POGLUT1-4836HCL | Recombinant Human KTELC1 293 Cell Lysate | +Inquiry |
FAM166A-261HCL | Recombinant Human FAM166A lysate | +Inquiry |
MTA1-4093HCL | Recombinant Human MTA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NSDHL Products
Required fields are marked with *
My Review for All NSDHL Products
Required fields are marked with *
0
Inquiry Basket