Recombinant Full Length Dictyostelium Discoideum Putative Uncharacterized Transmembrane Protein Ddb_G0285049(Ddb_G0285049) Protein, His-Tagged
Cat.No. : | RFL31239DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0285049(DDB_G0285049) Protein (Q54P08) (1-370aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-370) |
Form : | Lyophilized powder |
AA Sequence : | MVFLKVDCSKLFIFLCCIMSITILSFSLVFPYYESDFIIVNHTDIRNNTIVINKEFHQFQ FFGTYFYDINRFEMKTSFNQAYLITKRVSYDSYDSSTKNSVFQIITSMTLTSLIAKVFPI PILIVNMYINLQKPKRRYLNQIQQHHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNQNNNNNDNNDNNDVLDGANEVVINTMPTYEVLMERYQSSASYYLITQLVVNGVSFMIT LFSTFVVTHRISITMKLLTSIDEQIFNKPLCYTKNLDPFGYCNSFIGFSSTTSDENFMDF SWGPSFGWYLSLCSLCLDSFSIIVIIFLIITEGKLKKPKQPHKFTNILNLSDMDLINYRL LTLNQRIGTD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DDB_G0285049 |
Synonyms | DDB_G0285049; Putative uncharacterized transmembrane protein DDB_G0285049 |
UniProt ID | Q54P08 |
◆ Recombinant Proteins | ||
BRAF-550H | Active Recombinant Human BRAF/p50 Protein, Flag-His-tagged | +Inquiry |
RFL22410ZF | Recombinant Full Length Zygnema Circumcarinatum Cytochrome B6(Petb) Protein, His-Tagged | +Inquiry |
ADCK2-1681M | Recombinant Mouse ADCK2 Protein, His-tagged | +Inquiry |
SCG2-007H | Recombinant Human SCG2 Protein, MET1-Met617, C-His tagged | +Inquiry |
TRAPPC3-5166H | Recombinant Human TRAPPC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Myh2-13R | Active Native Rabbit Myosin II Protein | +Inquiry |
SHBG-30637TH | Native Human SHBG protein | +Inquiry |
Lectin-1733L | Active Native Lens Culinaris Agglutinin Protein, Rhodamine labeled | +Inquiry |
Trypsin-251H | Active Native Human Trypsin | +Inquiry |
B. garinii-22 | Native Borrelia garinii Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPAG8-1547HCL | Recombinant Human SPAG8 293 Cell Lysate | +Inquiry |
C21orf91-8095HCL | Recombinant Human C21orf91 293 Cell Lysate | +Inquiry |
PIK3R1-3185HCL | Recombinant Human PIK3R1 293 Cell Lysate | +Inquiry |
THOC6-1092HCL | Recombinant Human THOC6 293 Cell Lysate | +Inquiry |
DOHH-505HCL | Recombinant Human DOHH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDB_G0285049 Products
Required fields are marked with *
My Review for All DDB_G0285049 Products
Required fields are marked with *
0
Inquiry Basket