Recombinant Human TRAPPC3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TRAPPC3-5166H
• Product Overview: TRAPPC3 MS Standard C13 and N15-labeled recombinant protein (NP_055223) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a component of the trafficking protein particle complex, which tethers transport vesicles to the cis-Golgi membrane. The encoded protein participates in the regulation of transport from the endoplasmic reticulum to the Golgi apparatus. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 20.3 kDa
• AA Sequence: MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TRAPPC3 trafficking protein particle complex 3 [ Homo sapiens (human) ]
• Official Symbol: TRAPPC3
• Synonyms: TRAPPC3; trafficking protein particle complex 3; trafficking protein particle complex subunit 3; BET3; BET3 homolog; 1110058K12Rik
• Gene ID: 27095
• mRNA Refseq: NM_014408
• Protein Refseq: NP_055223
• MIM: 610955
• UniProt ID: O43617