Recombinant Full Length Debaryomyces Hansenii Nadh-Ubiquinone Oxidoreductase Chain 6(Nd6) Protein, His-Tagged
Cat.No. : | RFL33093DF |
Product Overview : | Recombinant Full Length Debaryomyces hansenii NADH-ubiquinone oxidoreductase chain 6(ND6) Protein (A9RAG2) (1-146aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Debaryomyces hansenii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-146) |
Form : | Lyophilized powder |
AA Sequence : | MNTISGMSSLTAIGMLTPVQSMTCLMILFVSTAMCLYSQGFVLMGMLYVTMYVGAMAMLF LFMLSLLKMEYTPQGTITPLMVTLLAMCLMPLDITYETYGMVTQMENVTDELVMVGNQLY TEYAMLLMLTGMMLMLSVMGAMSITK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ND6 |
Synonyms | ND6; NAD6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6 |
UniProt ID | A9RAG2 |
◆ Native Proteins | ||
APCS-31189TH | Native Human APCS | +Inquiry |
Acetate Kinase-22B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
PLAU-31689TH | Active Native Human Urokinase protein | +Inquiry |
IGHG3-231H | Native Human Immunoglobulin G3 (IgG3) | +Inquiry |
GOx-30A | Active Native Aspergillus Niger Glucose Oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAVCR1-2141HCL | Recombinant Human HAVCR1 cell lysate | +Inquiry |
Skeletal Muscle-55H | Human Skeletal Muscle Tissue Lysate | +Inquiry |
TEKT4P2-4703HCL | Recombinant Human LOC100132288 293 Cell Lysate | +Inquiry |
FANCE-594HCL | Recombinant Human FANCE cell lysate | +Inquiry |
MAPK1-692HCL | Recombinant Human MAPK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ND6 Products
Required fields are marked with *
My Review for All ND6 Products
Required fields are marked with *
0
Inquiry Basket