Recombinant Full Length Debaryomyces Hansenii Alpha-1,3/1,6-Mannosyltransferase Alg2(Alg2) Protein, His-Tagged
Cat.No. : | RFL3268DF |
Product Overview : | Recombinant Full Length Debaryomyces hansenii Alpha-1,3/1,6-mannosyltransferase ALG2(ALG2) Protein (Q6BVA4) (1-476aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Debaryomyces hansenii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-476) |
Form : | Lyophilized powder |
AA Sequence : | MSKKLGNNSKKIAFVHPDLGIGGAERLVVDAAVGLQELENEVTIYTSHCDKKHCFEEVSS NLLDVEVYGDFFPTNVLKRFHILFAIIRQFYLVLALIFTGKIKQYDYFIVDQLSFCIPLL CCFSRPECKILFYCHFPDQLLALKGGFLKRFYRMPFDLIEEWTTGISDQIVVNSKFTKGI FHKTFKGLKNIEPGVIYPCVDLNSATDTEEDKLMDEEVNEFFKGGKFFLSVNRFERKKNI GLAIQSFAKFKAQLPKNVSEDNRIKPRLVVAGGFDPRVLENVEYLQELNGLSESLNLKCF TIRGKLLIIPPATDILFLPSIKSSLKKSLIKNAELLLYTPSFEHFGIVPVESMLFKTPVL SANNGGPLESIVHFTSDNIATATGYSQEPNDELWSKTMHTFYTELDEATKLKLGENGLTR VHELFSRHQMSEAFMQNLIQSNSKDEEKGILYGILKMWRIELLFVLISYYLVRLYK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ALG2 |
Synonyms | ALG2; DEHA2C04158g; Alpha-1,3/1,6-mannosyltransferase ALG2; Asparagine-linked glycosylation protein 2; GDP-Man:Man(1GlcNAc(2-PP-Dol alpha-1,3-mannosyltransferase; GDP-Man:Man(1GlcNAc(2-PP-dolichol mannosyltransferase; GDP-Man:Man(2GlcNAc(2-PP-Dol alpha-1, |
UniProt ID | Q6BVA4 |
◆ Recombinant Proteins | ||
SPP1-447H | Recombinant Human SPP1 protein, His-tagged | +Inquiry |
S1PR3-4040H | Recombinant Human S1PR3 Protein, GST-tagged | +Inquiry |
sodB-3744A | Recombinant Anabaena sp. (strain L31) sodB protein, His-KSI-tagged | +Inquiry |
SRY-8738M | Recombinant Mouse SRY Protein, His (Fc)-Avi-tagged | +Inquiry |
PTPN1-220H | Recombinant Full Length Human PTPN1 protein, DDK-tagged | +Inquiry |
◆ Native Proteins | ||
CAPN1-186p | Active Native porcine Calpain-1 | +Inquiry |
PROC-273B | Active Native Bovine Protein C - DEGR (active site blocked) | +Inquiry |
F5-5300H | Native Human Coagulation Factor V (proaccelerin, labile factor) | +Inquiry |
Collagen-56B | Native Bovine Collagen Type II | +Inquiry |
CRP-5330H | Native Canine CRP protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
THOC6-1092HCL | Recombinant Human THOC6 293 Cell Lysate | +Inquiry |
ICOS-2444HCL | Recombinant Human ICOS cell lysate | +Inquiry |
ABCC6-6HCL | Recombinant Human ABCC6 cell lysate | +Inquiry |
EIF3I-6658HCL | Recombinant Human EIF3I 293 Cell Lysate | +Inquiry |
SYNE1-1319HCL | Recombinant Human SYNE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALG2 Products
Required fields are marked with *
My Review for All ALG2 Products
Required fields are marked with *
0
Inquiry Basket