Recombinant Human ALG2 Protein, Myc/DDK-tagged

• Cat.No.: ALG2-01H
• Product Overview: Recombinant protein of human asparagine-linked glycosylation 2, alpha-1, 3-mannosyltransferase homolog (S. cerevisiae) (ALG2), transcript variant 1 with a C-Myc/DDK tag was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the glycosyltransferase 1 family. The encoded protein acts as an alpha 1, 3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii). Alternative splicing results in multiple transcript variants.
• Molecular Mass: 46.9 kDa
• AA Sequence: MAEEQGRERDSVPKPSVLFLHPDLGVGGAERLVLDAALALQARGCSVKIWTAHYDPGHCFAESRELPVRCAGDWLPRGLGWGGRGAAVCAYVRMVFLALYVLFLADEEFDVVVCDQVSACIPVFRLARRRKKILFYCHFPDLLLTKRDSFLKRLYRAPIDWIEEYTTGMADCILVNSQFTAAVFKETFKSLSHIDPDVLYPSLNVTSFDSVVPEKLDDLVPKGKKFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLLVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 μg/mL as determined by microplate BCA method
• Storage Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Gene Information

• Gene Name: ALG2 ALG2 alpha-1, 3/1, 6-mannosyltransferase [ Homo sapiens (human) ]
• Official Symbol: ALG2
• Synonyms: ALG2; ALG2 alpha-1, 3/1, 6-mannosyltransferase; CDG1I; CDGIi; CMS14; NET38; CMSTA3; hALPG2; alpha-1, 3/1, 6-mannosyltransferase ALG2; GDP-Man:Man(1)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase; GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase; GDP-Man:Man(2)GlcNAc(2)-PP-Dol alpha-1, 6-mannosyltransferase; alpha-1, 3-mannosyltransferase ALG2; asparagine-linked glycosylation 2 homolog (S. cerevisiae, alpha-1, 3-mannosyltransferase); asparagine-linked glycosylation 2 homolog (yeast, alpha-1, 3-mannosyltransferase); asparagine-linked glycosylation 2, alpha-1, 3-mannosyltransferase homolog; asparagine-linked glycosylation protein 2 homolog; homolog of yeast ALG2; EC 2.4.1.132; EC 2.4.1.257
• Gene ID: 85365
• mRNA Refseq: NM_033087
• Protein Refseq: NP_149078
• MIM: 607905
• UniProt ID: Q9H553