Recombinant Full Length Danio Rerio Transmembrane Protein 237B(Tmem237B) Protein, His-Tagged
Cat.No. : | RFL2999DF |
Product Overview : | Recombinant Full Length Danio rerio Transmembrane protein 237B(tmem237b) Protein (Q66IE4) (1-413aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-413) |
Form : | Lyophilized powder |
AA Sequence : | MDPEAKVSSSRRRDLPPIPQGQRRTPRALPSMPSQDTAEEMPAPKSRKKKAKRDAESVDE PDDGGMEMGGLASRRQSECPEPLTPEPLDNPPQRRKKKKKAQAIDAEGDQTDLVSNGDTL DQNTDEEVTRKPKKRKVKPKVTETQSNNELDVEDDDVITDPQSPIPQHSLFSAPQGPSQP VGKVFVEKSRRFQAADRVEQWKPSGPIEQSIMDIRSMWTTRDVSMRVHSGFRVIGLFSHG FLAGYAVWNIIVVYVLAGDQMSSLSNLLQQFHTLAYPAQSLLYLLLALSTVSAFDRVNLA KAPAAMRSLLRLSPVALASVFYFSALVLSLSQQMTSDRINLYKYSSYNTTLWPPGSESSI LYPWITVNLVVSLLVGLAWILMSTSPDIDNTEAFLMSMEMEYPNSEEKGNVTA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tmem237b |
Synonyms | tmem237b; als2cr4b; zgc:101660; Transmembrane protein 237B; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein homolog B |
UniProt ID | Q66IE4 |
◆ Recombinant Proteins | ||
KMO-649H | Recombinant Human KMO | +Inquiry |
NOL12-6686HF | Recombinant Full Length Human NOL12 Protein, GST-tagged | +Inquiry |
CGA-210H | Human Chorionic Gonadotrophin, beta subunit (purified) Reference standard | +Inquiry |
SIGLEC6-446H | Recombinant Human SIGLEC6 Protein, Fc-tagged | +Inquiry |
CAND1-18H | Recombinant Human CAND1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-342R | Native RABBIT IgG | +Inquiry |
FSH-930B | Active Native Bovine FSH Protein | +Inquiry |
ACPP-5290H | Native Human Acid Phosphatase, Prostate | +Inquiry |
Luciferase-09F | Active Native Firefly Luciferase | +Inquiry |
Complement C4-50H | Native Human Complement C4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAS-001CCL | Recombinant Cynomolgus FAS cell lysate | +Inquiry |
POU6F1-2997HCL | Recombinant Human POU6F1 293 Cell Lysate | +Inquiry |
FSCN1-6133HCL | Recombinant Human FSCN1 293 Cell Lysate | +Inquiry |
C14orf166B-8280HCL | Recombinant Human C14orf166B 293 Cell Lysate | +Inquiry |
RECQL-2430HCL | Recombinant Human RECQL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tmem237b Products
Required fields are marked with *
My Review for All tmem237b Products
Required fields are marked with *
0
Inquiry Basket