Recombinant Full Length Human NOL12 Protein, GST-tagged

• Cat.No.: NOL12-6686HF
• Product Overview: Human NOL12 full-length ORF ( NP_077289.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 213 amino acids
• Description: NOL12 (Nucleolar Protein 12) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding and rRNA binding. An important paralog of this gene is ENSG00000100101.
• Molecular Mass: 51.1 kDa
• AA Sequence: MGRNKKKKRDGDDRRPRLVLSFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKEEQRKLREERHQEYLKMLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASSTEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKARHSGE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NOL12 nucleolar protein 12 [ Homo sapiens ]
• Official Symbol: NOL12
• Synonyms: NOL12; nucleolar protein 12; MGC3731; Nop25; RRP17; dJ37E16.7; FLJ34609
• Gene ID: 79159
• mRNA Refseq: NM_024313
• Protein Refseq: NP_077289
• UniProt ID: Q9UGY1