Recombinant Full Length Danio Rerio Glycerol-3-Phosphate Acyltransferase 3(Agpat9) Protein, His-Tagged
Cat.No. : | RFL12105DF |
Product Overview : | Recombinant Full Length Danio rerio Glycerol-3-phosphate acyltransferase 3(agpat9) Protein (Q6DG38) (1-449aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-449) |
Form : | Lyophilized powder |
AA Sequence : | MEGAWDVAFVLLHVWMSIVAGLIVLPAMFGVSLGFTDIYIKLLVKTLEWATLRIQRGQKE QPTLPLQLANGIIEKDDGSMEEEIVELRRSHPKNLAEGNFTLCDAFYFCKKGIENIVEDQ VTQRFSSEELASWNLLTRTNNNFRYISVRLTIIWGLGVFVRYCVLLPLRITLAVIGLSWL VIGTTLVGFLPNSKVKNWLSDLVHITCYRICARGLSATIRYHNKENRPKKGGICVANHTS PIDIVILANDGCYAMVGQVHGGLMGVIQRSMVRSCPHVWFERSEMKDRHAVAKRLKDHIS DKTKLPILIFPEGTCINNTSVMMFKKGSFEFGGTIYPVAIKYDPRFGDAFWNSAKYNMVS YILRMMTSWAIVCNVWYLPPMTQQDGEDAVHFANRVKSAIAHQGGLVDLSWDGGLKRSKV KESFKEEQQKMYSSMIVGLDSHEATVGPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gpat3 |
Synonyms | gpat3; agpat9; si:ch211-85e10.5; zgc:91857; Glycerol-3-phosphate acyltransferase 3; GPAT-3; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10; AGPAT 10; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9; 1-AGP acyltransferase 9; 1-AGPAT 9; Lysophosphat |
UniProt ID | Q6DG38 |
◆ Native Proteins | ||
GLDH-120B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
SNCA-27342TH | Native Human SNCA | +Inquiry |
C4-195H | Native Human Complement C4c | +Inquiry |
SERPINF2-27292TH | Native Human SERPINF2 | +Inquiry |
GOT1-01H | Active Native Human GOT1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SETMAR-1588HCL | Recombinant Human SETMAR cell lysate | +Inquiry |
Tonsil-535C | Cynomolgus monkey Tonsil Lysate | +Inquiry |
CNTFR-687HCL | Recombinant Human CNTFR cell lysate | +Inquiry |
E2F2-520HCL | Recombinant Human E2F2 cell lysate | +Inquiry |
CTTN-421HCL | Recombinant Human CTTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All gpat3 Products
Required fields are marked with *
My Review for All gpat3 Products
Required fields are marked with *
0
Inquiry Basket