Recombinant Full Length Saccharomyces Cerevisiae N-Acyl-Phosphatidylethanolamine-Hydrolyzing Phospholipase D, Mitochondrial(Fmp30) Protein, His-Tagged
Cat.No. : | RFL24578SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D, mitochondrial(FMP30) Protein (Q02883) (40-468aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (40-468) |
Form : | Lyophilized powder |
AA Sequence : | ASQKTRPIQKCSRKYARILLLSVLVPYTGYAFYVSLATVKQIDLRNEMCQRLEENNNEVT YKGSLLKYSPLEVLGRFENPFEEYRIQTVFEFFANRVFELFERNRGGIPRDVHQMNKLMP VHKPTWGPNLVDVDPAEETALPLECKVLDELHIPTAVEENEGSKCPVYNTWLGQSCNYTV YNGLRILTDPLFSDFLIHKTLGPKRITQMPSQITEVPKPDIILVSHNHPDHLDLESLEYW SGKDSPLWIVPKGMKSYMTSNGCDNVLELSWWETLQVKKNNEIYHISATPAMHWSGRSLL DTNKSLWCSFLLTHHGNPILFHAGDTGYVKDLFVRIKERFGKGCKLALLPCGQYCPEWHQ KPRHINPQEVLKIMKDLEARNVLGVHWGTFVLSGEYFLEPKEKLEMLAEWGGFKDRCYCP ELGKTECFD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FMP30 |
Synonyms | FMP30; YPL103C; N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D, mitochondrial; NAPE-PLD; NAPE-hydrolyzing phospholipase D; Found in mitochondrial proteome protein 30 |
UniProt ID | Q02883 |
◆ Recombinant Proteins | ||
VMP1-18350M | Recombinant Mouse VMP1 Protein | +Inquiry |
RTF1-5429Z | Recombinant Zebrafish RTF1 | +Inquiry |
HEPH-1596H | Recombinant Human HEPH protein, His-tagged | +Inquiry |
RFL30821OF | Recombinant Full Length Oryza Sativa Subsp. Japonica Apocytochrome F(Peta) Protein, His-Tagged | +Inquiry |
BGLAP-1473H | Recombinant Human BGLAP, His-tagged | +Inquiry |
◆ Native Proteins | ||
COD-39 | Active Native Choline oxidase | +Inquiry |
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
Annexin-V-009H | Native Human Annexin-V Protein | +Inquiry |
Lectin-1778G | Active Native Galanthus Nivalis Lectin Protein, Fluorescein labeled | +Inquiry |
KNG1-18H | Native Human Kininogen, LMW | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRR16-506HCL | Recombinant Human PRR16 lysate | +Inquiry |
SLC38A3-1632HCL | Recombinant Human SLC38A3 cell lysate | +Inquiry |
OSBPL6-1260HCL | Recombinant Human OSBPL6 cell lysate | +Inquiry |
PCDHGB4-3386HCL | Recombinant Human PCDHGB4 293 Cell Lysate | +Inquiry |
PAN2-3446HCL | Recombinant Human PAN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FMP30 Products
Required fields are marked with *
My Review for All FMP30 Products
Required fields are marked with *
0
Inquiry Basket