Recombinant Full Length Conjugal Transfer Protein Trag(Trag) Protein, His-Tagged
Cat.No. : | RFL25152EF |
Product Overview : | Recombinant Full Length Conjugal transfer protein traG(traG) Protein (Q00185) (1-635aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-635) |
Form : | Lyophilized powder |
AA Sequence : | MKNRNNAVGPQIRAKKPKASKTVPILAGLSLGAGLQTATQYFAHSFQYQAGLGWNINHVY TPWSILQWAGKWYGQYPDDFMRAASMGMVVSTVGLLGTAVTQMVKANTGKANDYLHGSAR WADKKDIQAAGLLPRPRTVVELVSGKHPPTSSGVYVGGWQDKDGKFHYLRHNGPEHVLTY APTRSGKGVGLVVPTLLSWAHSAVITDLKGELWALTAGWRKKHARNKVVRFEPASAQGSA CWNPLDEIRLGTEYEVGDVQNLATLIVDPDGKGLESHWQKTSQALLVGVILHALYKAKNE GTPATLPSVDGMLADPNRDVGELWMEMTTYGHVDGQNHPAVGSAARDMMDRPEEESGSVL STAKSYLALYRDPVVARNVSKSDFRIKQLMHHDDPVSLFIVTQPNDKARLRPLVRVMVNM IVRLLADKMDFENGRPVAHYKHRLLMMLDEFPSLGKLEILQESLAFVAGYGIKCYLICQD INQLKSRETGYGHDESITSNCHVQNAYPPNRVETAEHLSKLTGTTTIVKEQITTSGRRTS ALLGNVSRTFQEVQRPLLTPDECLRMPGPKKSADGSIEEAGDMVVYVAGYPAIYGKQPLY FKDPIFQARAAVPAPKVSDKLIQTATVEEGEGITI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | traG |
Synonyms | traG; Conjugal transfer protein TraG |
UniProt ID | Q00185 |
◆ Recombinant Proteins | ||
RFL3944EF | Recombinant Full Length Escherichia Coli Uncharacterized Protein Yhdv(Yhdv) Protein, His-Tagged | +Inquiry |
Ccdc97-2025M | Recombinant Mouse Ccdc97 Protein, Myc/DDK-tagged | +Inquiry |
NHAX-1460B | Recombinant Bacillus subtilis NHAX protein, His-tagged | +Inquiry |
CADM2-648H | Active Recombinant Human CADM2, Fc-tagged, Biotinylated | +Inquiry |
Epor-600M | Recombinant Mouse Epor protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
F2-276B | Active Native Bovine α-Thrombin-FPRck (FPR-CMK*) | +Inquiry |
LN-2686M | Native Mouse LN Protein | +Inquiry |
PGN-17S | Native S. aureus PGN Protein | +Inquiry |
Lectin-1806L | Active Native Lycopersicon Esculentum Lectin Protein | +Inquiry |
DPP4-31H | Active Native Human DPP4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHODL-1746MCL | Recombinant Mouse CHODL cell lysate | +Inquiry |
COTL1-7338HCL | Recombinant Human COTL1 293 Cell Lysate | +Inquiry |
AK9-125HCL | Recombinant Human AK9 lysate | +Inquiry |
C10orf2-8371HCL | Recombinant Human C10orf2 293 Cell Lysate | +Inquiry |
SGOL1-1594HCL | Recombinant Human SGOL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All traG Products
Required fields are marked with *
My Review for All traG Products
Required fields are marked with *
0
Inquiry Basket